KEGG   Homo sapiens (human): 9600
Entry
9600              CDS       T01001                                 

Gene name
PITPNM1, DRES9, NIR2, PITPNM, RDGB, RDGB1, RDGBA, RDGBA1, Rd9
Definition
(RefSeq) phosphatidylinositol transfer protein membrane associated 1
  KO
K24069  membrane-associated phosphatidylinositol transfer protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9600 (PITPNM1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    9600 (PITPNM1)
SSDB
Motif
Pfam: IP_trans DDHD Acid_phosphat_B
Other DBs
NCBI-GeneID: 9600
NCBI-ProteinID: NP_004901
OMIM: 608794
HGNC: 9003
Ensembl: ENSG00000110697
Vega: OTTHUMG00000167675
Pharos: O00562(Tbio)
UniProt: O00562 A0A024R5I7 B2R787
Position
11q13.2
AA seq 1244 aa
MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTH
KVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGG
QQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTA
AQTGPLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMAD
IRALEEETARMLAQRMAKCNTGSEGSEAQPPGKPSTEARSAASNTGTPDGPEAPPGPDAS
PDASFGKQWSSSSRSSYSSQHGGAVSPQSLSEWRMQNIARDSENSSEEEFFDAHEGFSDS
EEVFPKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELG
AEACAVHALFLILHSGNILDSGPGDANSKQADVQTLSSAFEAVTRIHFPEALGHVALRLV
PCPPICAAAYALVSNLSPYSHDGDSLSRSQDHIPLAALPLLATSSSRYQGAVATVIARTN
QAYSAFLRSPEGAGFCGQVALIGDGVGGILGFDALCHSANAGTGSRGSSRRGSMNNELLS
PEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAAPATTSSWEP
RRASTAFCPPAASSEAPDGPSSTARLDFKVSGFFLFGSPLGLVLALRKTVMPALEAAQMR
PACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLTVPRYQKFPLGDGSSLLLADTLQTHS
SLFLEELEMLVPSTPTSTSGAFWKGSELATDPPAQPAAPSTTSEVVKILERWWGTKRIDY
SLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEKERPQLAECEEPSIYSPAFP
REKWQRKRTQVKIRNVTSNHRASDTVVCEGRPQVLSGRFMYGPLDVVTLTGEKVDVYIMT
QPLSGKWIHFGTEVTNSSGRLTFPVPPERALGIGVYPVRMVVRGDHTYAECCLTVVARGT
EAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWL
SQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPS
QTYIVGRAVRKLQAQCQFLSDGYVAHLGQLEAGSHSHASSGPPRAALGKSSYGVAAPVDF
LRKQSQLLRSRGPSQAEREGPGTPPTTLARGKARSISLKLDSEE
NT seq 3735 nt   +upstreamnt  +downstreamnt
atgctcatcaaggaataccacattctgctgcccatgagcctggacgagtaccaggtggcc
cagctctacatgatccagaaaaagagccgggaggagtctagtggtgagggcagcggcgtg
gagatcctggccaaccggccctacacggatgggcccgggggcagcgggcaatacacacac
aaggtgtaccacgtgggctcccacatcccaggctggttccgggcactgctgcccaaggct
gccctgcaggtagaagaggaatcctggaatgcctacccctacacccgaacccggtacacc
tgccctttcgtggagaaattctccattgaaattgagacctattacctgcctgatgggggg
cagcagccaaacgtcttcaacctgagcggggccgagaggagacagcgcatcctggacacc
atcgacatcgtgcgggatgcagtggccccaggcgagtacaaagcagaagaggacccccgg
ctttatcactcggtcaagacgggccgagggccactgtctgatgactgggcacggacggcg
gcacagacggggccccttatgtgtgcctataagctgtgcaaggttgagttccgctactgg
ggcatgcaagccaagatcgagcagttcatccatgatgtaggtctgcgtcgggtgatgctg
cgggcccaccgccaggcctggtgctggcaggatgagtggacagagctgagcatggctgac
atccgggcactggaagaggagactgctcgcatgctggcccagcgcatggccaagtgcaac
acaggcagtgaggggtccgaggcccagccccccgggaaaccgagcaccgaggcccggtct
gcggccagcaacactggcacccccgatgggcctgaggcccccccaggcccagatgcctcc
cccgatgccagctttgggaagcagtggtcctcatcctcccgttcctcctactcatcccaa
catggaggggctgtgtctccccagagcttgtctgagtggcgcatgcagaacattgcccga
gactctgagaacagctccgaggaagagttctttgatgcccacgaaggcttctcggacagt
gaggaggtcttccccaaggagatgaccaagtggaactccaatgacttcattgatgccttt
gcctccccagtggaggcagagggaacgccagagcctggagccgaggcagctaaaggcatt
gaggatggggcccaagcacccagggactcagagggcctggatggagccggggagctgggg
gctgaggcatgcgcagtccacgccctcttccttatcctgcacagcggcaacatcctggac
tcaggccctggagacgccaactccaagcaggcggatgtgcagacgctgagctccgccttc
gaggccgtcacccgcatccacttccctgaggccttgggccacgtggcgctgcgactggtg
ccctgtccacccatctgcgccgccgcctatgcccttgtctccaacctgagcccttacagc
cacgatggggacagcctgtctcgctcccaagaccacattccactggctgccctgccactg
ctggccacctcatcctcccgctaccagggcgccgtggccaccgtcattgcccgcaccaac
caggcctactcagccttcctgcgctcacctgagggtgccggcttctgtgggcaggtcgca
ctgattggagatggtgttggtggcatcctgggctttgatgcactctgccacagtgctaac
gcgggcaccgggagtcggggcagcagccgccgtgggagcatgaacaatgagctgctctct
ccggagtttggcccagtgcgggaccccctggcagatggtgtggaaggcctgggtcggggc
agcccagaaccctcggccttgcctccccagcgcatccccagcgacatggccagtcctgag
cccgagggctctcagaacagccttcaggcagcccccgcaaccacctcctcctgggagccc
cggcgggcaagcacggccttctgcccacccgctgccagttccgaggcacctgacggcccc
agcagcactgcccgccttgacttcaaggtctctggcttcttcctcttcggctccccactg
ggcctggtgctggctctgcgcaaaactgtgatgcccgccctggaggcagcccagatgcgc
ccagcctgtgaacagatctacaacctcttccacgcggctgacccctgcgcctcacgcctc
gagcccctgctggccccgaagttccaggccatcgccccactgaccgtgccccgctaccag
aagttccccctgggagatggctcatccctgctgctggccgacactctgcagacgcactcc
agcctctttctggaggagctggagatgctggtgccctcaacacccacctctactagcggt
gccttctggaagggcagtgagttggccactgaccccccggcccagccagccgcccccagc
accaccagtgaggtggttaagatcctggagcgctggtgggggaccaagcggatcgactac
tcgctgtactgccccgaggcgctcaccgcctttcccaccgtcacgctgccccacctcttc
cacgccagctactgggagtccgccgacgtggtggcgttcatcctgcgccaggtgatcgag
aaggagcggccacagctggcggaatgcgaggagccgtccatctacagcccggccttcccc
agggagaagtggcagcgaaaacgcacgcaggtcaagatccggaacgtcacttccaaccac
cgggcgagcgacacggtggtgtgcgagggccgcccccaggtgctaagcgggcgcttcatg
tacgggcccctggacgtcgtcacgctcactggagagaaggtggatgtctacatcatgacg
cagccgctgtcgggcaagtggatccactttggcaccgaagtcaccaatagctcgggccgc
ctcaccttcccagttcccccagaacgcgcgctgggcattggtgtctaccccgtgcgcatg
gtggtcaggggcgaccacacctatgccgaatgctgcctgactgtggtggcccgcggcacg
gaggctgtggtcttcagcatcgacggctccttcaccgccagcgtctccatcatgggcagc
gaccccaaggtgcgagctggcgccgtggacgtggtcaggcactggcaggactccggctac
ctgatcgtgtatgtcacaggccggccggatatgcagaagcaccgcgtggtggcatggctg
tcgcagcacaacttcccccacggcgtcgtctccttctgcgacggcctcacccacgaccca
ctacgccagaaggcaatgtttctgcagagcctggtgcaggaggtagaactgaacatcgtg
gccggttatgggtctcccaaagatgtggctgtatacgcggcgctggggctgtccccgagc
cagacctacatcgtgggccgtgccgtgcggaagctacaggcgcagtgccagttcctgtca
gacggctatgtggcccacctgggccagctggaagcgggctcgcactcgcatgcctcctcg
ggacccccgagagctgccttgggcaagagcagctatggtgtggctgcccccgtggacttc
ctgcgcaaacagagccagctgcttcgctcgaggggccccagccaggcggagcgtgagggc
ccgggaacaccacccaccaccctggcacggggcaaagcacggagcatcagcctgaagctg
gacagcgaggagtga

DBGET integrated database retrieval system