KEGG   Homo sapiens (human): 9601Help
Entry
9601              CDS       T01001                                 

Gene name
PDIA4, ERP70, ERP72, ERp-72
Definition
(RefSeq) protein disulfide isomerase family A member 4
  KO
K09582  protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04918  Thyroid hormone synthesis
hsa05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9601 (PDIA4)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    9601 (PDIA4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    9601 (PDIA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9601 (PDIA4)
   04131 Membrane trafficking [BR:hsa04131]
    9601 (PDIA4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     9601 (PDIA4)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   9601 (PDIA4)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    9601 (PDIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 OST3_OST6 Thioredoxin_8 Calsequestrin Thioredoxin_7 AhpC-TSA TraF Thioredoxin_4 FAM176 Glyco_hydro_106
Motif
Other DBs
NCBI-GeneID: 9601
NCBI-ProteinID: NP_004902
HGNC: 30167
Ensembl: ENSG00000155660
Vega: OTTHUMG00000150248
Pharos: P13667(Tbio)
UniProt: P13667 A0A090N8Y2
Structure
PDB: 

Position
7q36.1
AA seq 645 aa AA seqDB search
MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKE
ENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKI
DATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTL
VLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAE
TDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
KDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQP
EKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILD
ESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVM
DPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGF
PTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggaaagccttcctgctcctgctgctcttggggctggtgcagctgctggcc
gtggcgggtgccgagggcccggacgaggattcttctaacagagaaaatgccattgaggat
gaagaggaggaggaggaggaagatgatgatgaggaagaagacgacttggaagttaaggaa
gaaaatggagtcttggtcctaaatgatgcaaactttgataattttgtggctgacaaagac
acagtgctgctggagttttatgctccatggtgtggacattgcaagcagtttgctccggaa
tatgaaaaaattgccaacatattaaaggataaagatcctcccattcctgttgccaagatc
gatgcaacctcagcgtctgtgctggccagcaggtttgatgtgagtggctaccccaccatc
aagatccttaagaaggggcaggctgtagactacgagggctccagaacccaggaagaaatt
gttgccaaggtcagagaagtctcccagcccgactggacgcctccaccagaagtcacgctt
gtgttgaccaaagagaactttgatgaagttgtgaatgatgcagatatcattctggtggag
ttttatgccccatggtgtggacactgcaagaaacttgcccccgagtatgagaaggccgcc
aaggagctcagcaagcgttctcctccaattcccctggcaaaggtcgacgccaccgcagaa
acagacctggccaagaggtttgatgtctctggctatcccaccctgaaaattttccgcaaa
ggaaggccttatgactacaacggcccacgagaaaaatatggaatcgttgattacatgatc
gagcagtccgggcctccctccaaggagattctgaccctgaagcaggtccaggagttcctg
aaggatggagacgatgtcatcatcatcggggtctttaagggggagagtgacccagcctac
cagcaataccaggatgccgctaacaacctgagagaagattacaaatttcaccacactttc
agcacagaaatagcaaagttcttgaaagtctcccaggggcagttggttgtaatgcagcct
gagaaattccagtccaagtatgagccccggagccacatgatggacgtccagggctccacc
caggactcggccatcaaggacttcgtgctgaagtacgccctgcccctggttggccaccgc
aaggtgtcaaacgatgctaagcgctacaccaggcgccccctggtggtcgtctactacagt
gtggacttcagctttgattacagagctgcaactcagttttggcggagcaaagtcctagag
gtggccaaggacttccctgagtacacctttgccattgcggacgaagaggactatgctggg
gaggtgaaggacctggggctcagcgagagtggggaggatgtcaatgccgccatcctggac
gagagtgggaagaagttcgccatggagccagaggagtttgactctgacaccctccgcgag
tttgtcactgctttcaaaaaaggaaaactgaagccagtcatcaaatcccagccagtgccc
aagaacaacaagggacccgtcaaggtcgtggtgggaaagacctttgactccattgtgatg
gaccccaagaaggacgtcctcatcgagttctacgcgccatggtgcgggcactgcaagcag
ctagagcccgtgtacaacagcctggccaagaagtacaagggccaaaagggcctggtcatc
gccaagatggacgccactgccaacgacgtccccagcgaccgctataaggtggagggcttc
cccaccatctacttcgcccccagtggggacaaaaagaacccagttaaatttgagggtgga
gacagagatctggagcatttgagcaagtttatagaagaacatgccacaaaactgagcagg
accaaggaagagctttga

DBGET integrated database retrieval system