KEGG   Homo sapiens (human): 9615
Entry
9615              CDS       T01001                                 

Gene name
GDA, CYPIN, GAH, GUANASE, NEDASIN
Definition
(RefSeq) guanine deaminase
  KO
K01487  guanine deaminase [EC:3.5.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    9615 (GDA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.3  guanine deaminase
     9615 (GDA)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 9615
NCBI-ProteinID: NP_004284
OMIM: 139260
HGNC: 4212
Ensembl: ENSG00000119125
Vega: OTTHUMG00000020005
Pharos: Q9Y2T3(Tbio)
UniProt: Q9Y2T3 A0A024R231
Structure
PDB: 
4AQL 3E0L 2UZ9

Position
9q21.13
AA seq 454 aa
MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCF
KPCEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFA
EEVYTRVVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEY
KETTEESIKETERFVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSH
ISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAH
CPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVSNILLINKVNE
KSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtgtgccgctcagatgccgcccctggcgcacatcttccgagggacgttcgtccactcc
acctggacctgccccatggaggtgctgcgggatcacctcctcggcgtgagcgacagcggc
aaaatagtgtttttagaagaagcatctcaacaggaaaaactggccaaagaatggtgcttc
aagccgtgtgaaataagagaactgagccaccatgagttcttcatgcctgggctggttgat
acacacatccatgcctctcagtattcctttgctggaagtagcatagacctgccactcttg
gagtggctgaccaagtacacatttcctgcagaacacagattccagaacatcgactttgca
gaagaagtatataccagagttgtcaggagaacactaaagaatggaacaaccacagcttgt
tactttgcaacaattcacactgactcatctctgctccttgccgacattacagataaattt
ggacagcgggcatttgtgggcaaagtttgcatggatttgaatgacacttttccagaatac
aaggagaccactgaggaatcgatcaaggaaactgagagatttgtgtcagaaatgctccaa
aagaactattctagagtgaagcccatagtgacaccacgtttttccctctcctgctctgag
actttgatgggtgaactgggcaacattgctaaaacccgtgatttgcacattcagagccat
ataagtgaaaatcgtgatgaagttgaagctgtgaaaaacttataccccagttataaaaac
tacacatctgtgtatgataaaaacaatcttttgacaaataagacagtgatggcacacggc
tgctacctctctgcagaagaactgaacgtattccatgaacgaggagcatccatcgcacac
tgtcccaattctaatttatcgctcagcagtggatttctaaatgtgctagaagtcctgaaa
catgaagtcaagatagggctgggtacagacgtggctggtggctattcatattccatgctt
gatgcaatcagaagagcagtgatggtttccaatatccttttaattaataaggtaaatgag
aaaagcctcaccctcaaagaagtcttcagactagctactcttggaggaagccaagccctg
gggctggatggtgagattggaaactttgaagtgggcaaggaatttgatgccatcctgatc
aaccccaaagcatccgactctcccattgacctgttttatggggacttttttggtgatatt
tctgaggctgttatccagaagttcctctatctaggagatgatcgaaatattgaagaggtt
tatgtgggcggaaagcaggtggttccgttttccagctcagtgtaa

DBGET integrated database retrieval system