KEGG   Homo sapiens (human): 9751Help
Entry
9751              CDS       T01001                                 

Gene name
SNPH
Definition
(RefSeq) syntaphilin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaphilin CALCOCO1 Fez1 Exonuc_VII_L TPR_MLP1_2 Lebercilin MPS2 BST2 DUF641 Spc7 Sec2p PKcGMP_CC CcdA AAA_23 DUF16 ArAE_1_C HMMR_N DUF4407 CC2-LZ FAM76
Motif
Other DBs
NCBI-GeneID: 9751
NCBI-ProteinID: NP_055538
OMIM: 604942
HGNC: 15931
Ensembl: ENSG00000101298
Vega: OTTHUMG00000031662
Pharos: O15079(Tbio)
UniProt: O15079
Position
20p13
AA seq 494 aa AA seqDB search
MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTL
CSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQED
WIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETL
LHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDG
ADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGM
EAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRD
PNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSY
WSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVALHSIRRISCRSL
SQPSPSPAGGGSQL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtccctgccaggaagtagacggacctctgctggatcacgcaggcgcacctct
ccacctgtgagcgtgcgggatgcctacggcacctcttcgctcagcagcagcagcaattct
ggctcctacaagggcagtgacagcagtcccacgccaaggcgctccatgaaatacacgctg
tgcagtgacaaccatggcatcaagcccccgaccccggagcagtacctgacccccctgcag
cagaaggaggtgtgcatccggcacctgaaagcccggctgaaggacacacaggaccggctc
caggaccgggacacagagattgatgacctgaagacgcagctgtcacgcatgcaggaggac
tggattgaggaggagtgccaccgcgtggaggcccagctggccctgaaggaggcccgaaag
gagatcaagcagctcaagcaggtcatcgacactgtcaagaacaacctgattgacaaggac
aaggggctgcagaagtacttcgtggacatcaacatccagaacaagaagctggagacgctg
ctgcacagcatggaggtggcccagaatggcatggccaaggaggatggcactggggagtca
gccggtgggtcccctgcccgctccctcacccgcagctccacctacaccaagctgagtgac
ccggctgtctgtggtgaccgccagccgggtgatccctccagcggctctgctgaggatggg
gcagacagtggctttgcagcagccgatgacacactgagccggacggacgcgctggaagcc
agcagcctgctgtcgtcgggggtggactgtggcaccgaggagacctcgctgcacagctcc
ttcggcctgggcccccgcttccctgccagcaacacctatgagaagctgctgtgtggcatg
gaggctggtgtgcaggccagctgcatgcaggagcgtgccatccagacagacttcgtgcag
taccagcctgaccttgacaccatcctggagaaagtgacccaggcccaggtctgtgggaca
gaccctgagtcaggggacaggtgcccagagctggatgcccacccttcagggcccagagac
cccaactcagcagtggtggtgacagtgggtgatgagctagaggccccagagcccatcacc
cgtggacccaccccacagcggcctggtgccaaccccaaccctggccagtcggtgagcgtg
gtgtgccccatggaagaggaggaggaggctgccgtggctgagaaggagcccaagagctac
tggagccgccactacatcgtggatctgctggctgtggtggtgccggccgtgcccacggtg
gcctggctttgccgctcccagcggcgccagggccagcccatctacaacatcagctccctg
ctgcggggctgctgcactgtggccttgcactccatccgcaggatcagctgccgctcgctg
agccagccgagtcccagcccagcgggcggcggctcccagctctga

DBGET integrated database retrieval system