KEGG   Homo sapiens (human): 9784Help
Entry
9784              CDS       T01001                                 

Gene name
SNX17
Definition
(RefSeq) sorting nexin 17
  KO
K17929  sorting nexin-17
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    9784 (SNX17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNX17_FERM_C PX RA FERM_M Nod1 Ras_bdg_2 DUF2777
Motif
Other DBs
NCBI-GeneID: 9784
NCBI-ProteinID: NP_055563
OMIM: 605963
HGNC: 14979
Ensembl: ENSG00000115234
Vega: OTTHUMG00000097781
Pharos: Q15036(Tbio)
UniProt: Q15036
Structure
PDB: 

Position
2p23.3
AA seq 470 aa AA seqDB search
MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFP
PKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLE
VLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQ
EFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVT
KEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQ
LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQ
WVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE
SPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcacttttccattcccgaaaccgagtcccgcagcggggacagcggcggctccgcctac
gtggcctataacattcacgtgaatggagtcctgcactgtcgggtgcgctacagccagctc
ctggggctgcacgagcagcttcggaaggagtatggggccaatgtgcttcctgcattcccc
ccaaagaagcttttctctctgactcctgctgaggtagaacagaggagagagcagttagag
aagtacatgcaagctgttcggcaagacccattgcttgggagcagcgagactttcaacagt
ttcctgcgtcgggcacaacaggagacacagcaggtccccacagaggaagtgtccttggaa
gtgctgctcagcaacgggcagaaagttctggtcaacgtgctaacttcagatcagactgag
gatgtcctggaggctgtagctgcaaagctggatcttccagatgacttgattggatacttt
agtctattcttagttcgagaaaaagaggatggagccttttcttttgtacggaagttgcaa
gagtttgagctgccttatgtgtctgtcaccagccttcggagtcaagagtataagattgtg
ctaaggaagagttattgggactctgcctatgatgacgatgtcatggagaaccgggttggc
ctgaacctgctttatgctcagacggtatcagatattgagcgtgggtggatcttggtcacc
aaggaacagcaccggcaactcaaatctctgcaagagaaagtctccaagaaggagttcctg
agactggcccagacgctgcggcactatggctacttgcgctttgatgcctgtgtggctgac
ttcccagaaaaggactgtcctgtggtggtgagcgcgggcaacagtgagctcagcctgcag
ctccgcctgcctggccagcaactccgagaaggctccttccgggtcacccgcatgcgatgc
tggcgggtcacctcctctgtaccattgcccagtggaagcacgagcagcccaggccggggc
cggggtgaggtgcgcctggaactggcttttgaatacctcatgagcaaggaccggctacag
tgggtcaccatcactagcccccaggctatcatgatgagcatctgcttgcagtccatggtt
gatgaactgatggtgaagaaatctggcggcagtatcaggaagatgctgcgccggcgggtg
gggggtactctgagacgctcagacagccagcaagcagtgaagtccccaccactgcttgag
tcacctgatgccacccgggagtctatggtcaaactctcaagtaagctgagtgccgtgagc
ttgcggggaattggcagtcccagcacagatgccagtgccagtgatgtccacggcaatttc
gccttcgagggcattggagatgaggatctgtaa

DBGET integrated database retrieval system