KEGG   Homo sapiens (human): 9813
Entry
9813              CDS       T01001                                 

Gene name
EFCAB14, KIAA0494
Definition
(RefSeq) EF-hand calcium binding domain 14
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EF-hand_7 Choline_kin_N BLOC1_2 EF-hand_5 NPV_P10 DUF1664 TOM20_plant Baculo_PEP_C DUF730
Other DBs
NCBI-GeneID: 9813
NCBI-ProteinID: NP_055589
HGNC: 29051
Ensembl: ENSG00000159658
Vega: OTTHUMG00000007992
Pharos: O75071(Tdark)
UniProt: O75071
Position
1p33
AA seq 495 aa
MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSDSESSSEEEEEFGVVGNRSRF
AKGDYLRCCKICYPLCGFVILAACVVACVGLVWMQVALKEDLDALKEKFRTMESNQKSSF
QEIPKLNEELLSKQKQLEKIESGEMGLNKVWINITEMNKQISLLTSAVNHLKANVKSAAD
LISLPTTVEGLQKSVASIGNTLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPG
SNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSALVGYQRQNDLKLEGMNETVS
NLTQRVNLIESDVVAMSKVEKKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKE
DSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVESFTSKPSALPKFSQFLGDPVE
KAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDG
DGRYSFLELRVALGI
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaaaaagcgcaaagagctcaatgcattgattggtttggctggggacagccggagaaag
aagcccaagaaaggcccaagcagtcaccgcctgcttcgcactgagcctcccgactcagac
tctgagtccagctccgaagaggaagaggaattcggtgtggttggaaatcgctctcgcttt
gccaagggagactatttacgatgctgcaagatctgttatccgctctgtggttttgtcatc
cttgctgcctgtgttgtggcctgtgttggcttggtgtggatgcaggttgctctcaaggag
gatctggatgccctcaaggaaaaatttcgaacaatggaatctaatcagaaaagctcattc
caagaaatccccaaacttaatgaagaactactcagcaagcaaaaacaacttgagaagatt
gaatctggagagatgggtttgaacaaagtctggataaacatcacagaaatgaataagcag
atttctctgttgacttctgcagtgaaccacctcaaagccaatgttaagtcagctgcagac
ttgattagcctgcctaccactgtagagggacttcagaagagtgtagcttccattggcaat
actttaaacagcgtccatcttgctgtggaagcactacagaaaactgtggatgaacacaag
aaaacgatggaattactgcagagtgatatgaatcagcacttcttgaaggagactcctgga
agcaaccagatcattccgtcaccttcagccacatcagaacttgacaataaaacccacagt
gagaatttgaaacaggatatcctgtaccttcacaactctttagaggaggtaaacagtgcc
ctagtggggtaccagagacagaatgatcttaaactcgagggaatgaacgagacagtcagt
aatcttacccagagagtcaacctgatagaaagcgatgtggttgctatgagcaaggtagaa
aagaaagcaaacctgtccttcagcatgatgggtgatagatctgccactctgaaaagacag
tctttggatcaagtcaccaacagaacagatacagtaaaaatccaaagcataaagaaagaa
gatagttcaaattctcaggtatccaagctaagagagaaactccagctgatcagtgctctt
acaaacaaacctgagagcaacaggcctccagagaccgccgatgaagagcaagtagagagt
ttcacatcaaagccatcagcattgccaaaattttcacagtttcttggagacccagttgag
aaagctgcccaactaagacctatctccctaccaggagtttctagcactgaagatcttcag
gatttattccgcaagactggccaggacgtggatgggaagctgacctaccaggaaatctgg
acctccctaggttctgctatgccagaaccagagagcttgagagcatttgattccgatgga
gatggaagatactcattcctggagctaagggtagctttaggtatctag

DBGET integrated database retrieval system