KEGG   Homo sapiens (human): 9817Help
Entry
9817              CDS       T01001                                 

Gene name
KEAP1, INrf2, KLHL19
Definition
(RefSeq) kelch like ECH associated protein 1
  KO
K10456  kelch-like protein 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Disease
H00048  Hepatocellular carcinoma
Drug target
Dimethyl fumarate: D03846
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9817 (KEAP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9817 (KEAP1)
   05225 Hepatocellular carcinoma
    9817 (KEAP1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    9817 (KEAP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     9817 (KEAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_3 BTB Kelch_2 Kelch_4 Kelch_5
Motif
Other DBs
NCBI-GeneID: 9817
NCBI-ProteinID: NP_036421
OMIM: 606016
HGNC: 23177
Ensembl: ENSG00000079999
Vega: OTTHUMG00000180579
Pharos: Q14145(Tclin)
UniProt: Q14145 A0A024R7C0
Structure
PDB: 

Position
19p13.2
AA seq 624 aa AA seqDB search
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagatcccaggcctagcggggctggggcctgctgccgattcctgcccctgcag
tcacagtgccctgagggggcaggggacgcggtgatgtacgcctccactgagtgcaaggcg
gaggtgacgccctcccagcatggcaaccgcaccttcagctacaccctggaggatcatacc
aagcaggcctttggcatcatgaacgagctgcggctcagccagcagctgtgtgacgtcaca
ctgcaggtcaagtaccaggatgcaccggccgcccagttcatggcccacaaggtggtgctg
gcctcatccagccctgtcttcaaggccatgttcaccaacgggctgcgggagcagggcatg
gaggtggtgtccattgagggtatccaccccaaggtcatggagcgcctcattgaattcgcc
tacacggcctccatctccatgggcgagaagtgtgtcctccacgtcatgaacggtgctgtc
atgtaccagatcgacagcgttgtccgtgcctgcagtgacttcctggtgcagcagctggac
cccagcaatgccatcggcatcgccaacttcgctgagcagattggctgtgtggagttgcac
cagcgtgcccgggagtacatctacatgcattttggggaggtggccaagcaagaggagttc
ttcaacctgtcccactgccaactggtgaccctcatcagccgggacgacctgaacgtgcgc
tgcgagtccgaggtcttccacgcctgcatcaactgggtcaagtacgactgcgaacagcga
cggttctacgtccaggcgctgctgcgggccgtgcgctgccactcgttgacgccgaacttc
ctgcagatgcagctgcagaagtgcgagatcctgcagtccgactcccgctgcaaggactac
ctggtcaagatcttcgaggagctcaccctgcacaagcccacgcaggtgatgccctgccgg
gcgcccaaggtgggccgcctgatctacaccgcgggcggctacttccgacagtcgctcagc
tacctggaggcttacaaccccagtgacggcacctggctccggttggcggacctgcaggtg
ccgcggagcggcctggccggctgcgtggtgggcgggctgttgtacgccgtgggcggcagg
aacaactcgcccgacggcaacaccgactccagcgccctggactgttacaaccccatgacc
aatcagtggtcgccctgcgcccccatgagcgtgccccgtaaccgcatcggggtgggggtc
atcgatggccacatctatgccgtcggcggctcccacggctgcatccaccacaacagtgtg
gagaggtatgagccagagcgggatgagtggcacttggtggccccaatgctgacacgaagg
atcggggtgggcgtggctgtcctcaatcgtctcctttatgccgtggggggctttgacggg
acaaaccgccttaattcagctgagtgttactacccagagaggaacgagtggcgaatgatc
acagcaatgaacaccatccgaagcggggcaggcgtctgcgtcctgcacaactgtatctat
gctgctgggggctatgatggtcaggaccagctgaacagcgtggagcgctacgatgtggaa
acagagacgtggactttcgtagcccccatgaagcaccggcgaagtgccctggggatcact
gtccaccaggggagaatctacgtccttggaggctatgatggtcacacgttcctggacagt
gtggagtgttacgacccagatacagacacctggagcgaggtgacccgaatgacatcgggc
cggagtggggtgggcgtggctgtcaccatggagccctgccggaagcagattgaccagcag
aactgtacctgttga

DBGET integrated database retrieval system