KEGG   Homo sapiens (human): 989Help
Entry
989               CDS       T01001                                 

Gene name
SEPTIN7, CDC10, CDC3, NBLA02942, SEPT7, SEPT7A
Definition
(RefSeq) septin 7
  KO
K16944  septin 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    989 (SEPTIN7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    989 (SEPTIN7)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    989 (SEPTIN7)
   04147 Exosome [BR:hsa04147]
    989 (SEPTIN7)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    989 (SEPTIN7)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     989 (SEPTIN7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   989 (SEPTIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 AAA_16 GTP_EFTU AAA_22 Ras FeoB_N ABC_tran AAA_29 Roc Gtr1_RagA Fez1
Motif
Other DBs
NCBI-GeneID: 989
NCBI-ProteinID: NP_001779
OMIM: 603151
HGNC: 1717
Ensembl: ENSG00000122545
Vega: OTTHUMG00000155063
Pharos: Q16181(Tbio)
UniProt: Q16181
Structure
PDB: 

Position
7p14.2
AA seq 437 aa AA seqDB search
MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESG
LGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDA
VDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFM
KRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKI
KDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDV
TNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQV
FEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQ
QNSSRTLEKNKKKGKIF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcagtgcgagatccgctgctgctgaggagaggagcgtcaacagcagcaccatg
gtagctcaacagaagaaccttgaaggctatgtgggatttgccaatctcccaaatcaagta
tacagaaaatcggtgaagagaggttttgaattcacgcttatggtagtgggtgaatctgga
ttgggaaagtcgacattaatcaactcattattcctcacagatttgtattctccagagtat
ccaggtccttctcatagaattaaaaagactgtacaggtggaacaatccaaagttttaatc
aaagaaggtggtgttcagttgctgctcacaatagttgataccccaggatttggagatgca
gtggataatagtaattgctggcagcctgttatcgactacattgatagtaaatttgaggac
tacctaaatgcagaatcacgagtgaacagacgtcagatgcctgataacagggtgcagtgt
tgtttatacttcattgctccttcaggacatggacttaaaccattggatattgagtttatg
aagcgtttgcatgaaaaagtgaatatcatcccacttattgccaaagcagacacactcaca
ccagaggaatgccaacagtttaaaaaacagataatgaaagaaatccaagaacataaaatt
aaaatatacgaatttccagaaacagatgatgaagaagaaaataaacttgttaaaaagata
aaggaccgtttacctcttgctgtggtaggtagtaatactatcattgaagttaatggcaaa
agggtcagaggaaggcagtatccttggggtgttgctgaagttgaaaatggtgaacattgt
gattttacaatcctaagaaatatgttgataagaacacacatgcaggacttgaaagatgtt
actaataatgtccactatgagaactacagaagcagaaaacttgcagctgtgacttataat
ggagttgataacaacaagaataaagggcagctgactaagagccctctggcacaaatggaa
gaagaaagaagggagcatgtagctaaaatgaagaagatggagatggagatggagcaggtg
tttgagatgaaggtcaaagaaaaagttcaaaaactgaaggactctgaagctgagctccag
cggcgccatgagcaaatgaaaaagaatttggaagcacagcacaaagaattggaggaaaaa
cgtcgtcagttcgaggatgagaaagcaaactgggaagctcaacaacgtattttagaacaa
cagaactcttcaagaaccttggaaaagaacaagaagaaagggaagatcttttaa

DBGET integrated database retrieval system