KEGG   Homo sapiens (human): 9901Help
Entry
9901              CDS       T01001                                 

Gene name
SRGAP3, ARHGAP14, MEGAP, SRGAP2, WRP
Definition
(RefSeq) SLIT-ROBO Rho GTPase activating protein 3
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    9901 (SRGAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9901 (SRGAP3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    9901 (SRGAP3)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    9901 (SRGAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP FCH SH3_1 SH3_2 SH3_9 Adhesin_P1_N Flg_hook
Motif
Other DBs
NCBI-GeneID: 9901
NCBI-ProteinID: NP_055665
OMIM: 606525
HGNC: 19744
Ensembl: ENSG00000196220
Vega: OTTHUMG00000090589
Pharos: O43295(Tbio)
UniProt: O43295
Position
3p25.3
AA seq 1099 aa AA seqDB search
MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIE
LEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESK
LKEAEKQEEKQFNKSGDLSMNLLRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKAR
NDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD
VIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRYH
QLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYM
SKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQTLGEGERAECGTTRP
PCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRYINLYGLQQQGI
FRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDL
ISTIKLENPAERVHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMHIPDGQDPVSCQAHINEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYCDSPH
SEPGAIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYMGRSPRELSFKKGASLLLYHRASED
WWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTE
HISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIP
LTRGRIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHSSLGDHKSLEAEAL
AEDIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPVSSEPASPLHTIVIRD
PDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSSSSSSSGVGSPA
VTPTEKMFPNSSADKSGTM
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcaaactaagttcaagaaagacaaagagatcattgctgaatatgaagcccaa
ataaaagagatccgcacgcagctggtggagcagttcaaatgtctggagcagcaatcagag
tcgcgactgcagctgcttcaagacctccaggagtttttccgccggaaagctgagattgag
ctcgagtactcccgcagcctggagaagctggctgagcgcttctcctccaaaatccgcagc
tcccgggagcaccagttcaagaaggaccagtacctcctctcgcctgtgaactgttggtat
ctggttctgcatcagacccggcgggagagccgagaccatgccaccctcaatgacatcttc
atgaacaatgtcatcgtccgcctctcccagatcagtgaggatgtcatcagactcttcaaa
aagagcaaggagattggcctgcagatgcacgaggagctcctgaaggtgaccaatgagctc
tacacagtcatgaaaacctaccacatgtaccatgcagagagcatcagtgcggaaagcaag
ctgaaggaggctgagaagcaggaggagaagcagttcaataagtcaggagacctcagcatg
aacctgctccggcacgaggaccggccccagcgccgcagctctgtgaagaagattgagaag
atgaaggagaagaggcaggccaagtactctgagaacaagctgaaatgcacaaaggcccgg
aatgactacttgctcaatctggcagccaccaacgcagctataagcaaatactacatccat
gatgtctctgatctgatcgattgctgtgatttgggcttccatgccagcctggcccgcacc
ttccggacctatctctcagctgaatacaacctggagacctctcgccacgaagggctggat
gtcattgagaatgcagtggacaacctggattcccgaagtgacaagcacacagtcatggac
atgtgcaatcaagtcttctgccctccactcaagttcgagttccagccccacatgggggat
gaggtctgccaggtcagcgctcagcagcccgtccagacagaactgctcatgcgttatcac
cagctgcagtccagactggccaccctcaagatagagaatgaggaggttaggaaaaccctg
gatgccaccatgcagacattacaggacatgctgactgtggaggactttgatgtctccgat
gccttccaacacagtcgatcgacagagtccgtcaagtcggctgcctctgagacctacatg
agcaagatcaacattgccaagaggagagccaaccagcaggaaacagaaatgttttatttt
acaaaatttaaagagtatgtgaatggcagtaacctcatcaccaagctgcaggccaagcac
gatttactcaagcagaccctgggcgaaggggaaagagcagaatgcggcaccaccaggccc
ccctgtcttccccctaaaccacagaaaatgaggagacctaggcctctctcagtgtatagc
cataaactctttaacggcagtatggaagcattcattaaggattcaggacaagctataccg
cttgtagtcgagagctgcatccgttacatcaatttatatggactccagcagcaggggatc
ttcagagtgccaggatctcaggtggaagtcaatgacatcaaaaattcctttgagagaggt
gaagacccccttgtggacgatcaaaatgaacgagatatcaattcagtcgctggtgtttta
aaactgtatttccgaggactggaaaacccactctttcctaaggaaaggtttcaagatttg
atatctactattaaactggagaacccagccgagagggtgcaccagatccaacaaatcctc
gtcacccttccccgcgtggtcattgtggtcatgagatacctcttcgctttcctcaaccac
ctctcccagtatagcgacgagaacatgatggatccctacaacctggccatctgcttcggg
cctaccctcatgcacatccctgatgggcaggaccctgtgtcctgccaggcacacatcaat
gaagtcatcaaaaccatcatcatccatcatgaagccatcttccccagcccccgggagcta
gagggacctgtgtatgaaaaatgcatggctggaggggaagaatattgtgacagcccacac
agcgagccaggggccatcgatgaagttgaccatgacaatggcactgagcctcataccagc
gatgaagaagtggagcagatcgaggctattgccaagtttgactacatggggcggtccccg
cgtgagctatccttcaagaagggggcctcgctgctcctgtaccaccgcgcctcggaggac
tggtgggagggccggcacaacggcgtggatggactcatcccccatcagtacatagttgta
caggacatggatgatgccttctccgacagcctgagccagaaggctgacagcgaggccagc
agtgggccattgctggatgacaaggcctcttccaaaaacgacctccagtcccccacggag
cacatctcggattacggctttgggggggtgatgggccgagtgcggttacgatctgatgga
gcagccatccccagacgccgaagcgggggcgacacacacagcccgccccggggcctgggc
cccagcatagacacaccaccccgggctgctgcctgccccagcagcccccacaaaatcccc
ctcacccgggggaggatcgagagccctgagaagcggaggatggcgacgttcgggagcgct
ggcagcatcaactaccctgacaagaaggcgctctccgaagggcactcgatgaggtcgacc
tgcggttccaccaggcacagcagcctaggggaccacaagtccctggaggccgaggccctg
gcagaagacatcgagaagaccatgagcacggctctgcacgagttgcgggaactcgagagg
cagaacacggtcaagcaggcgccagatgtggtgctggacaccctggagcccctgaagaac
ccgccaggccccgtcagctcggagcccgccagtccccttcacaccatcgtcatccgcgac
cccgatgccgccatgcgccgcagcagcagctcctccaccgagatgatgaccaccttcaag
ccagccctgtccgcccgcctggctggcgcccagctccgcccgccccccatgcggcccgtg
cggccggtggtccagcaccggtccagcagcagcagcagctcgggcgtgggcagcccggcc
gtgacgcccaccgagaagatgttccccaacagctcagcggacaagtcgggcaccatgtga

DBGET integrated database retrieval system