KEGG   Homo sapiens (human): 9902Help
Entry
9902              CDS       T01001                                 

Gene name
MRC2, CD280, CLEC13E, ENDO180, UPARAP
Definition
(RefSeq) mannose receptor C type 2
  KO
K06560  mannose receptor, C type
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9902 (MRC2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    9902 (MRC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9902 (MRC2)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    9902 (MRC2)
   04090 CD molecules [BR:hsa04090]
    9902 (MRC2)
   04091 Lectins [BR:hsa04091]
    9902 (MRC2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    9902 (MRC2)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   9902 (MRC2)
CD molecules [BR:hsa04090]
 Proteins
  9902 (MRC2)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 6: Mannose receptor family
   9902 (MRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C fn2 UL45 Chordopox_A33R
Motif
Other DBs
NCBI-GeneID: 9902
NCBI-ProteinID: NP_006030
OMIM: 612264
HGNC: 16875
Ensembl: ENSG00000011028
Vega: OTTHUMG00000179178
Pharos: Q9UBG0(Tbio)
UniProt: Q9UBG0
Structure
PDB: 

Position
17q23.2
AA seq 1479 aa AA seqDB search
MGPGRPAPAPWPRHLLRCVLLLGCLHLGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGARTSNISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQV
TYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDE
VMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPD
PTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEE
HFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDD
DIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFF
EHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRF
RWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQ
PPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQ
AFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAPGEPSGPSPAPSGNKPTSCAV
VLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLL
QKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVS
EEPLNYVGWQDGEPQQPGGCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGS
CPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQS
YEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWR
PGACTNITMGVVCKLPRAEQSSFSPSALPENPAALVVVLMAVLLLLALLTAALILYRRRQ
SIERGAFEGARYSRSSSSPTEATEKNILVSDMEMNEQQE
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atggggcccggccggccggcccccgcgccctggcctcgtcacctgctgcgctgcgtcctg
ctcctcgggtgcctgcacctcggccgtcccggcgcccctggggacgccgccctcccggaa
cccaacgtcttcctcatcttcagccatggactgcagggctgcctggaggcccagggcggg
caggtcagagtcaccccggcttgcaataccagcctccctgcccagcgctggaagtgggtc
tcccgaaaccggctattcaacctgggtaccatgcagtgcctgggcacaggctggccaggc
accaacaccacggcctccctgggcatgtatgagtgtgaccgggaagcactgaatcttcgc
tggcattgtcgtacactgggtgaccagctgtccttgctcctgggggcccgcaccagcaac
atatccaagcctggcacccttgagcgtggtgaccagacccgcagtggccagtggcgcatc
tacggcagcgaggaggacctatgtgctctgccctaccacgaggtctacaccatccaggga
aactcccacggaaagccgtgcaccatccccttcaaatatgacaaccagtggttccacggc
tgcaccagcacgggccgcgaggatggtcacctgtggtgtgccaccacccaggactacggc
aaagacgagcgctggggcttctgccccatcaagagtaacgactgcgagaccttctgggac
aaggaccagctgactgacagctgctaccagtttaacttccagtccacgctgtcgtggagg
gaggcctgggccagctgcgagcagcagggtgcggatctgctgagcatcacggagatccac
gagcagacctacatcaacggcctcctcactgggtacagctccaccctgtggatcggcttg
aatgacttggacacgagcggaggctggcagtggtcggacaactcgcccctcaagtacctc
aactgggagagtgaccagccggacaaccccagtgaggagaactgtggagtgatccgcact
gagtcctcgggcggctggcagaaccgtgactgcagcatcgcgctgccctatgtgtgcaag
aagaagcccaacgccacggccgagcccacccctccagacaggtgggccaatgtgaaggtg
gagtgcgagccgagctggcagcccttccagggccactgctaccgcctgcaggccgagaag
cgcagctggcaggagtccaagaaggcatgtctacggggcggtggcgacctggtcagcatc
cacagcatggcggagctggaattcatcaccaagcagatcaagcaagaggtggaggagctg
tggatcggcctcaacgatttgaaactgcagatgaattttgagtggtctgacgggagcctt
gtgagcttcacccactggcacccctttgagcccaacaacttccgggacagtctggaggac
tgtgtcaccatctggggcccggaaggccgctggaacgacagtccctgtaaccagtccttg
ccatccatctgcaagaaggcaggccagctgagccagggggccgccgaggaggaccatggc
tgccggaagggttggacgtggcacagcccatcctgctactggctgggagaagaccaagtg
acctacagtgaggcccggcgcctgtgcactgaccatggctctcagctggtcaccatcacc
aacaggttcgagcaggccttcgtcagcagcctcatctacaactgggagggcgagtacttc
tggacggccctgcaggacctcaacagcaccggctccttcttctggctcagtggggatgaa
gtcatgtacacccactggaaccgggaccagcccgggtacagccgtgggggctgcgtggcg
ctggccactggcagcgccatggggctgtgggaggtgaagaactgtacctcgttccgggcc
cgctacatctgccggcagagcctgggcactccagtgacgccggagctgccggggccagat
cccacgcccagcctcactggctcctgtccccagggctgggcctcggacaccaaactccgg
tattgctataaggtgttcagctcagagcggctgcaggacaagaagagctgggtccaggcc
cagggggcctgccaggagctgggggcccagctgctgagcctggccagctacgaggaggag
cactttgtggccaacatgctcaacaagatcttcggtgaatcagaacccgagatccacgag
cagcactggttctggatcggcctgaaccgtcgggatcccagagggggtcagagttggcgc
tggagcgacggcgtagggttctcttaccacaatttcgaccggagccggcacgacgacgac
gacatccgaggctgtgcggtgctggacctggcctccctgcagtgggtggccatgcagtgc
gacacacagctggactggatctgcaagatccccagaggtacggacgtgcgggagcccgac
gacagccctcaaggccgacgggaatggctgcgcttccaggaggccgagtacaagttcttt
gagcaccactccacgtgggcgcaggcgcagcgcatctgcacgtggttccaggccgagctg
acctcggtgcacagccaggcggagctagacttcctgagccacaacttgcagaagttctcc
cgggcccaggagcagcactggtggatcggcctgcacacctctgagagcgatgggcgcttc
agatggacagatggttccattataaacttcatctcctgggcaccaggcaaacctcggcct
gtcggcaaggacaagaagtgcgtgtacatgacagccagccgagaggactggggggaccag
aggtgcctgacagccttgccctacatctgcaagcgcagcaacgtcaccaaagaaacgcag
cccccagacctgccaactacagccctggggggctgcccctctgactggatccagttcctc
aacaagtgttttcaggtccagggccaggaaccccagagccgggtgaagtggtcagaggca
cagttctcctgtgaacagcaagaggcccagctggtcaccatcacaaaccccttagagcaa
gcattcatcacagccagcctgcccaatgtgacctttgacctttggattggcctccatgcc
tcgcagagggacttccagtgggtggagcaggagcctttgatgtatgccaactgggcacct
ggggagccctctggccctagccctgctcccagtggcaacaaaccgaccagctgtgcagtg
gtcctgcacagcccctcagcccacttcactggccgctgggacgatcggagctgcacggag
gagacccatggcttcatctgccagaagggcacggacccctccctgagcccgtccccagca
gcgctgccccccgccccgggcactgagctctcctacctcaacggcaccttccggctgctt
cagaagccgctgcgctggcacgatgccctcctgctgtgtgagagccgcaatgccagcctg
gcctacgtgcccgacccctacacccaggccttcctcacgcaggctgcccgagggctgcgc
acgccgctctggattgggctggctggcgaggagggctctcggcggtactcctgggtctca
gaggagccgctgaactacgtgggctggcaggacggggagccgcagcagccggggggctgt
acctacgtagatgtggacggggcctggcgcaccaccagctgtgacaccaagctgcagggg
gctgtgtgtggggttagcagtgggccccctcctccccgaagaataagctaccatggcagc
tgtccccagggactggcagactccgcgtggattcccttccgggagcactgctattctttc
cacatggagctgctgctgggccacaaggaggcgcgacagcgctgccagagagcgggtggg
gccgtcctgtctatcctggatgagatggagaatgtgtttgtctgggagcacctgcagagc
tatgagggccagagtcggggcgcctggctgggcatgaacttcaaccccaaaggaggcact
ctggtctggcaggacaacacagctgtgaactactccaactgggggcccccgggcttgggc
cccagcatgctgagccacaacagctgctactggattcagagcaacagcgggctatggcgc
cccggcgcttgcaccaacatcaccatgggtgtcgtctgcaagcttcctcgtgctgagcag
agcagcttctccccatcagcgcttccagagaacccagcggccctggtggtggtgctgatg
gcggtgctgctgctcctggccttgctgaccgcagccctcatcctttaccggaggcgccag
agcatcgagcgcggggcctttgagggtgcccgctacagccgcagcagctccagccccacc
gaggccactgagaagaacatcctggtgtcagacatggaaatgaatgagcaacaagaatag

DBGET integrated database retrieval system