KEGG   Intestinimonas butyriciproducens: IB211_03343c
Entry
IB211_03343c      CDS       T04182                                 

Definition
(GenBank) Xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ibu  Intestinimonas butyriciproducens
Pathway
ibu00230  Purine metabolism
ibu01100  Metabolic pathways
ibu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    IB211_03343c
Enzymes [BR:ibu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     IB211_03343c
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ALP95731
UniProt: A0A0S2W8S7
Position
complement(3331982..3334300)
AA seq 772 aa
MEVGRSLTRVDAFDKVTGRAKYTDDLHGEAILVARILHSTIANGVVRSMDISEAQAVPGV
VKVLTCFDVPDIQYPTPGHPWSVEEAHQDVADRKLLAIRVRIYGDDIAVVVAENELAAQR
GLEAIRVEYEEYPVCTTPEQAMAEGALPIHEEHPDNVLKHTLFNVITPGAAIKDVDEVFA
DPAYRVFEDHFDTQAVQHCHIENPVSYAYMEAGRIVVVSSTQIPHIVRRVIGQALGIGWG
NIRVIKPYIGGGFGNKQEVLYEPLNAWITTQVGGRPVKLECTREETFQNTRSRHPIHFDL
KAAVGPDMRLMARECRAVSNQGGYASHGHAIVANAVTGFRQTYPDVLAHRSEAWTVYTNL
GSTGAMRGYGIPQCNFAGECMMDDIAREMGWDPLEFRLKNSMPLGYVDPTNGITCHSTGL
RDCIRKGADFIRWRELREKYAHETGAIRRGVGMAVFSYKTGVWPISLETSSARIILNQDG
TVQLQLGATEIGQGGDTVFSQMCAQAVGIPTEDVHIVSFQDTDTAPFDTGAYASRQTYVT
GKAIKRAGEIFRDKVLDYAAELTDLDPGNLDIRGRDVVSTVSGAPVLRMADLAMEAFYSL
QHCVHITAEATVQCKNNTFSFGCCFAEVEVDIPVGKVRVLRIVNVHDSGRLINPKLAEAQ
VHGGMSMGMGYALSEEMKYDDKGRLLNGNLLDYKLPTAMDHPEFHALFVETDDPSGPFGN
KSLGEPPAIPVAGAIRNAVLQATGVGLRRLPMNPQRLVEAFTEAGLIEKVGD
NT seq 2319 nt   +upstreamnt  +downstreamnt
gtggaagttggcagaagtctgactcgcgtagacgcctttgacaaggtgacggggcgggcc
aagtatacggacgatctccacggtgaggccatccttgtggccagaatcctccacagcacc
attgcaaacggcgtggtcagatccatggacatttcagaagcccaggcggtccccggcgtg
gtgaaggtgctcacctgttttgatgtgcccgacatccagtatcccacgccgggccatccc
tggagtgtggaggaggcacaccaggacgtggccgaccgaaagctgctggccatccgggta
cgcatctatggggacgacatcgccgtagtggtagcggaaaatgagctggcagcgcagcgg
gggctggaggccatccgggtggagtatgaggagtaccccgtttgcaccacgccggaacag
gcgatggcggagggggcccttcccatccacgaggagcacccggacaatgtcttgaagcac
actctgttcaacgtgatcaccccgggcgcggcgataaaggatgtggatgaggtctttgcc
gatcccgcctaccgggtcttcgaggaccacttcgacacccaggccgttcagcactgccac
atcgagaacccggtgtcttacgcctatatggaagccgggcgcatcgtggtggtgtcctcc
acccagatcccccatatcgtccgccgcgtcatcggccaggccctgggcatcggctggggc
aacatacgggtcatcaagccctatatcggcggcgggttcgggaataaacaggaggtactt
tacgaacctctcaatgcctggatcaccacccaggtgggcggccgaccggtgaaactggag
tgcacccgggaggagacctttcaaaatacccgctcccgccatcccatccacttcgacctg
aaggccgccgtggggccggatatgcgccttatggcccgggagtgccgggcggtctccaat
caggggggctacgcctcccacggccatgccatcgtggccaatgccgtcaccggcttccgc
cagacctatcccgatgtcctggcccaccgctccgaggcatggacggtgtacaccaatctg
ggctctaccggcgccatgcggggctacggcatcccgcagtgcaattttgccggcgagtgc
atgatggacgacatcgcccgggagatggggtgggatccgctggaattccggctgaaaaac
agtatgccgctgggctacgtggaccccaccaacggcatcacgtgccactccaccggactc
cgggactgcatccggaagggtgcggatttcatcaggtggagggagctgcgggagaaatat
gcccatgagaccggagccatccgccggggtgtgggcatggcggtcttttcctataagacc
ggcgtgtggcccatctccctggagacctcgtcggcccggatcatcctcaaccaggacggt
accgtgcagctccagctcggggccacggagatcggacaggggggcgacaccgtcttttcc
cagatgtgcgcgcaggccgtgggcatccccaccgaggatgtacatatcgtctctttccag
gacaccgacacggcgccctttgacaccggtgcctatgcatcccggcagacctatgtcacc
ggtaaggccatcaaaagggcgggagagatcttccgggacaaggtactggactatgcagcc
gagctcaccgatctggacccgggcaatctggacatccggggccgggatgtggtgtccaca
gtcagcggcgcgcctgtgctgcgcatggcggacctggcgatggaggccttttactctctg
cagcactgtgtccacatcaccgctgaggccaccgtccagtgcaagaacaataccttttcc
ttcggctgctgctttgccgaggtggaggtggacatcccggtgggcaaggtgcgggtgctc
cgcatcgtgaatgttcacgattccggaaggctcatcaatcccaagctggccgaggcacag
gtgcacggcggcatgagcatggggatgggatatgccctctcagaggagatgaagtacgat
gacaagggccgcctcctcaacggcaatctgctggactataagctgcccaccgcgatggac
cacccggagttccacgccctcttcgtggagaccgacgacccctcggggccctttgggaac
aaatccctgggagagccgccggccattcctgtggccggcgcgatccgaaacgccgtgctc
caggccaccggcgtgggcctccgccgcctgcccatgaatccgcagcggctggtggaggcc
tttacggaggcgggactcatcgagaaagtgggggattga

DBGET integrated database retrieval system