KEGG   Kryptolebias marmoratus (mangrove rivulus): 108231405
Entry
108231405         CDS       T05608                                 

Gene name
apln
Definition
(RefSeq) apelin isoform X1
  KO
K05225  apelin
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04080  Neuroactive ligand-receptor interaction
kmr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108231405 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108231405 (apln)
SSDB
Motif
Pfam: Apelin CCAP
Other DBs
NCBI-GeneID: 108231405
NCBI-ProteinID: XP_017263944
Position
Unknown
AA seq 94 aa
MNVKILTLVIVLLVSLLCSASAVNEEGKHTTETEGLLLQRHGPMASTEHGRGLEETATVR
KMAQQNPVRGGQTHRPAKRRRPRPRLSHKGPMPF
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctgtgaatgaagaagggaaacacacaacggaaacagaaggcctgcttctccaacgc
catggtcccatggcctccacagagcatggcagagggctggaagagacagctacagtgaga
aaaatggcccagcagaatcctgtgagaggtggtcagacccacagaccagccaagagaaga
cgcccacggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system