KEGG   Klebsiella pneumoniae 342: KPK_1783Help
Entry
KPK_1783          CDS       T00772                                 

Definition
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPK_1783
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_1783
Enzymes [BR:kpe01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     KPK_1783
Secretion system [BR:kpe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   KPK_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagE_TrbE_VirB VirB3 AAA_22 ABC_tran Pox_A32 AAA_29 FtsK_SpoIIIE ResIII DUF87
Motif
Other DBs
NCBI-ProteinID: ACI09642
UniProt: B5XPN7
Position
complement(1847938..1850685)
Genome map
AA seq 915 aa AA seqDB search
MATLNKALTRPAAIMGIPLVPFVLVSGAIVLLAVYVSYYLAVLLIPAWAEMKNKARKDIH
YFSLLWLAFKTRGRLFTNTHFGANALLANQYDNVDVSEFIQKMKLSERITLDKYIPYSSH
IHPYVIRNRHRDFVATWELGGTVFECEDEHHLTLMATHLNNVIRSYEGLPLTFYIHRLRE
KYHDVFEACSGIPFSDEVTRRYYQPVKEKPFWRHRLFFTVCYAPFSQIEKKTMKAQPHGK
RLAALDDALKIMLEYREALESSLSRYMAMPLGIYEENGRVYSSQVAFFHRLITGQWQKVA
VTRSPFYETLSTPDVFFTTDTGECQTVSGSRFFRSLEIKDYSPETHTGMLDALLYAESEY
VLTQSFTCMARDEAQHHIRLAEKRLNSTDDDATSQREELIVLRDLLQSGHVSCGKFHFSL
LISSDSAGQVVKDTNVLAQPFADLGIMTTLSTLSLPAAYLAQLPGVYTLRPRLVAVSSQN
FADMACLHNFHPHKRSGNPWREAVAILTSPGGGGYYLNLHDSQAGRDDTGEKTPGNTAII
GKTGSGKTLLMTIMQQLMQKYRNPASFAPSATIKRLTTVYFDKDRAAEMAIRQMGGRYFR
IRTGEPTGFNPFALEPTRRNISFIKRLVRMLCRRNGKPLDPRDEERISAAVDTIMLDYPP
EYRRYGITRLLEVLPEPPTTDARTNGLRIRLKQWAQGGEFGWVFDNEADTFTISDVDNFG
IDGTEFLDDDDIRGPVTFYLLYRVTSLLDGRRLVMFMDEFWRWLADVEFSRFSLNMLKVI
RKLNGIFVPATQSPDEIVRHPIAPAIIEQCGTQIFLANPKASYADYVEKMKVPESVYDTV
RNLDPGEHYMVILKTPLQAGETRPFVAMAKMDLSGLGKLTRLLSGSEDNLKIFDAIYQDG
MRPDEWKETFLERAI
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggctacgctgaataaagcactgacgcggcctgccgccattatgggtattcctctggtg
ccgttcgttctcgtcagcggggccatcgtcctgctggcggtctatgtcagctattacctg
gcggttctgctcattcctgcctgggcggaaatgaaaaacaaagcccgaaaggatattcat
tatttcagtctgctctggctggcgtttaaaacccgtggacgacttttcaccaatacccat
tttggcgcgaatgccctgctggcaaaccagtacgataacgttgatgtctcggagtttatt
cagaaaatgaaattaagcgagcgtattacgctggataaatatattccgtactcctcccat
attcacccttacgtcatcagaaaccgtcaccgtgattttgttgccacctgggagctgggc
ggcacggtctttgaatgtgaagacgaacatcacctgaccctcatggctactcacctgaat
aacgttattcgttcgtatgagggtctgccgttaacattctatattcaccggctccgtgaa
aaataccatgatgtttttgaagcctgttccggtattcccttttccgatgaggtaacacgt
cggtattaccagccggtaaaagaaaaaccgttctggcggcaccggctgtttttcaccgtc
tgctacgcaccgttctctcagattgagaagaaaaccatgaaagcgcaaccgcacggtaaa
cgcctggcagcactggatgacgcgctcaaaatcatgctggaataccgcgaagcactggaa
tcttcattatcccgctatatggcaatgccgctggggatatatgaagaaaacgggcgggta
tattcctcgcaagtggcgttcttccaccgcctgatcaccggccagtggcagaaagtggcc
gtaacgcgctcgccgttttatgaaacgttaagcacgccggacgtgtttttcaccaccgac
accggtgaatgccagacggtcagcggttcccgcttcttccgcagccttgagattaaggat
tattccccggaaacccatactggtatgctggatgcgctgctgtacgccgaaagcgagtat
gttctgacgcagtcctttacctgcatggcacgggatgaggcgcagcatcatatccggctg
gcggaaaaacggcttaactccacggacgacgacgcgacttcccagcgcgaagagctgatt
gtcctgcgcgacctgctccagtccgggcatgtgtcgtgcggtaaattccacttttccctg
ctgatctcctcagacagtgccggacaggtggtgaaggacactaacgttctggcccagccc
ttcgccgatctgggtattatgacaacgctctccaccctgtcactgcccgccgcatatctg
gctcaactgccgggagtctatacgctgcgtccccgactggtagccgtcagcagccagaat
tttgccgatatggcctgcctgcataacttccatccccacaaacgcagcggtaatccgtgg
agggaagccgtcgccatcctcacatctcccggcggtggcgggtattacctcaacctgcac
gacagccaggcagggcgggatgacaccggtgagaaaacgccggggaatacggcgattatc
gggaaaaccggctccggtaaaaccctgctgatgaccatcatgcaacaactgatgcagaag
taccgtaacccggcgtcgtttgcgccttctgccaccatcaaacggctgaccacggtgtat
ttcgataaggatcgggcggcggagatggcgatccgccagatgggtggacgatacttccgc
atccgtaccggcgagcccaccggcttcaacccgtttgcactggagccaacccgccggaac
atcagtttcatcaaacggctggtgcgcatgctgtgccgccgcaacggtaagccgctcgat
ccccgcgatgaggagcggatcagtgccgccgtggacaccatcatgctggactatccgccg
gagtaccgccggtacgggatcacccggctgctggaagtgctgccggagccgccgaccaca
gacgcccgcaccaacgggctgcgtattcgcctgaaacagtgggcgcaggggggcgagttc
ggctgggtgtttgataacgaggccgatacattcaccatcagcgatgtcgataactttggt
atcgacggcaccgaatttctggatgatgacgatattcgcggtcccgtgaccttttacctg
ctgtaccgtgtgaccagccttctggacggtcgccgtctggtgatgtttatggatgagttc
tggcgctggctggccgatgtcgaattttcccgcttctccctcaatatgctgaaagtcatc
cgaaagctgaacggtatcttcgttccggcaacacagtcaccggatgaaatcgtcagacac
cccatcgccccggcgattattgagcagtgcggtacccagattttcctcgcaaatccgaaa
gccagctatgcggattacgtggagaaaatgaaagtgccggaaagtgtttatgacacggtc
agaaaccttgatccgggcgagcattatatggtcatcctgaaaacaccgttacaggccgga
gaaacccgcccgtttgtggcaatggcgaaaatggatctgtccggactgggtaaactcacc
cggcttctcagcggcagtgaggacaacctgaaaatattcgatgccatttatcaggacggt
atgcgacctgatgaatggaaagaaaccttccttgagcgggcaatctaa

DBGET integrated database retrieval system