KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01675Help
Entry
CLIBASIA_01675    CDS       T00948                                 

Definition
(GenBank) two-component sensor histidine kinase/response regulator hybrid protein
  KO
K13587  two-component system, cell cycle sensor histidine kinase and response regulator CckA [EC:2.7.13.3]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02020  Two-component system
Brite
KEGG Orthology (KO) [BR:las00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLIBASIA_01675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:las01001]
    CLIBASIA_01675
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:las02022]
    CLIBASIA_01675
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CLIBASIA_01675
Protein kinases [BR:las01001]
 Histidine kinases
  Cell cycle family [OT]
   CLIBASIA_01675
Two-component system [BR:las02022]
 Cell cycle family
  CckA-CtrA/CpdR (cell cycle control)
   CLIBASIA_01675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c PAS_4 PAS PAS_9 PAS_8 HisKA DUF3240
Motif
Other DBs
NCBI-ProteinID: ACT56923
UniProt: C6XEX1
Position
362702..365113
Genome map
AA seq 803 aa AA seqDB search
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALT
NAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWY
RLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQG
KILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRR
IDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMA
IASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDI
SPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAV
GTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFS
RKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNL
CVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEK
IFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQES
HYSHDIAIIPQEEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKV
MEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFS
FLSKPFSLKQLATSVHELLQSDS
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctatcgttgggatattattattgctactgctcgcaattggttctattgaaatg
acaataaaaccgaagattcctcttgaaacaatttttatggatagtgaaccagaggggata
ttaattacaaatgaacgtgggcatataatttatgcaaataatgcatataatgcacttacc
aatgctgtctggaacaaaagaactaaatctttggaaagtcttctctcgcgcaatcaagaa
gctagcgaagcgctttatcgccttatcaacagcttgcgtttaaaaagcgaaggtagtgaa
gagtttcgtttaatgcaatctttaaacaactattctcaaaattctgaacctcattggtat
cgtcttaaagcacgggttctacctatttcattacataaagaaaaattgctatatgcatgg
cgtatcactgatattacttccgaacgcaaggatcaggaaaagttctttcgagaattacaa
aatgctattgattaccttgatcattctcctgtaggctttatgtcagccgatcatcaaggg
aaaattttgtatattaatgctactcttgcagaatggattggcattgatcttactacgttt
acatcaaaatcaatatctatcggagatattacagcgggagaaggactggccctcattcaa
gctattcgcacagaacccagccatcaaaaaattacaacattagatttagatctgcgccga
atagataatggacatggaattcctgtaaaaattgtacaccatatcttggcttcatgcgac
ggcaagcccggagaaagccgcactgttgtcgtctctcgcaaaaactgtgattccggcgat
ccatctggaacaatcgcaaatatgcgctttaaccgtttttttaataatatacctatggct
atcgcttctatcgataagaaaggcagaattctacgtaccaacgcacattttcttaaactt
tttcctaattgtacggaaggcgatggcacttctaatgatatattctccattgtccataaa
aacgaaaaacgcaagattatcgctgctctatatgatgcaaacgatcagaaaagtgatatt
tcccctattgattctcctcatccccaagacgaaaatcgctactttcgtttttatatcagc
gccacacttgaccgtagtacagaagcacctgaggaacaagcaattctgtatactgttgaa
ataacagaacaaaaagccctagaagcacgtatggcacagactcaaaaattaaatgctgtt
ggcacgcttgctgggggaatagctcatgactttaacaatgtgctcaccgcaattcttcta
tcttctgatcatttattattacaatcacgctcttctgatgctagttttgccgatcttatg
gagataaagcataatgctaatcgcgcagcaatcttagtacggcaattgcttgctttttct
agaaaacaaaccatgcgccttacggtactcaaccttaccgaggtaatcggtaatttacgt
atgatgattcaaaaattaatttctgaacctccacaagtgaaactcaccgtagattatgaa
cgtgacttgtggggtgtcaaaaccgatttatctcagttcgaacaggtattagtaaacctg
tgtgttaacgctcatcacgcgataatgctcaaagaaagtggttctttgaccgtgcgcact
cgtaatattccatcaacagaaatacacacctttaattattcagatcttccaacaaaagat
atggtattagtagaagtagaagatacggggattggaatgtctcctgatattatggaaaaa
atattcgagccattctttactactaaaaaagtaggagaaggaacagggctaggactttca
gttgtttatggaataatacgacaatctggcggatacatattacccgaatctgaagtaggg
aaaggcactatattccgtatatttttgccaagatatgttcaagagcatactcaagaatcc
cattactcccacgatattgctattataccacaagaagaacccgcagatctgacaggaaat
tcagctatagtcttacttgtagaagatgaagattctgtgcgacgtggtagcaaaagaatg
ctagaaacacgtggttatactgtacatgaagcgttctctggaacggatgctctaaaggtt
atggaaaaactacaaggccgcgttgatattgttatctctgatgtagtgatgcccgaaatg
gatggaccaacactccttcgcgaattaagaaaaacgtatccaagtttaaaatttatcttt
atttccggctatgcagaagatgcattttctaagaatttacctaaagatgccaagttcagt
tttttatcaaaaccattttcgctcaaacaattagctacatccgttcatgaacttctccag
tcagattcttaa

DBGET integrated database retrieval system