KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03930Help
Entry
CLIBASIA_03930    CDS       T00948                                 

Gene name
quaB
Definition
(GenBank) inosine 5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00230  Purine metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
Module
las_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLIBASIA_03930 (quaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:las04147]
    CLIBASIA_03930 (quaB)
Enzymes [BR:las01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     CLIBASIA_03930 (quaB)
Exosome [BR:las04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CLIBASIA_03930 (quaB)
  Exosomal proteins of breast cancer cells
   CLIBASIA_03930 (quaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh NanE Glu_synthase His_biosynth DeoC
Motif
Other DBs
NCBI-ProteinID: ACT57362
UniProt: C6XG59
Structure
PDB: 

Position
864881..866362
Genome map
AA seq 493 aa AA seqDB search
MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDS
RLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKK
YSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLH
QHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGP
LFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIK
VGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSA
CVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPE
GIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDV
KITRESPNYSETI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaattattgaaaataatgtaggcggtgtagcactaacatttgatgatgtttta
ttgcggccagaattttctaatgttttgccaagagatattgatatatctacacgaatagca
aaggattttaccttgaatttgcctattatgtcagctgctatggatcaggtgactgattcg
cgtctcgctatagcaatggcacaagcaggtggtttaggtgtcatacatagaaatttttct
ccttctgagcaagttgcccaagtacatcaggtcaaaaaatttgaaagtgggatggttgtt
aatcctgtgaccatttccccttacgccacattggcagatgcattggctttgatgaaaaaa
tatagtatatcaggcattcctgttgttgaatctgatgttggaaaattagttggtatatta
actaatcgagatgtacgtttcgcttctaatgctcagcaagcagtaggcgaattgatgact
cgaaatttgattacggtgaagaaaacagtcaatctagaaaatgccaaggcgttgcttcat
caacaccgaattgaaaaattgcttgttgttgatgatgatggttgttgtataggattgatc
accgtcaaagacatagaaagatcacagcttaatccaaatgcaacaaaggatagtaaaggg
cgtttacgagttgcagctgctgtttcagtagcgaaggatattgcagatcgagtaggtcct
ctttttgatgtgaatgttgatttagtagttgttgacactgctcatggacattctcaaaag
gttttggatgcagtggttcaaattaagaaaaactttccttctttgttggtgatggcagga
aatattgctactgctgaaggggcattggcattgattgatgcaggtgctgacattataaaa
gttggtataggtcctggatcaatttgtacaactagggttgtaacaggagttggttgtccg
cagctttctgctattatgtcggttgttgaagtagcggagcgtgctggtgttgcgattgtt
gctgatggaggtattagattttctggtgatattgctaaagcaattgccgcgggttctgca
tgtgtaatgatagggtctttgcttgcgggcactgacgaaagtccgggggatatttttctt
tatcaaggacgctcctttaaatcttacagggggatgggatctgttgctgctatggaacgt
ggatcttctgcgcgttattctcaggatggagtaaccgacgtattaaaattagtacctgaa
ggtatagagggtcgagtaccctataaggggcctatagcatcggttcttcatcagatgtcg
ggtgggcttaagtcttctatgggatatgtaggggcttcaaatatagaagagtttcagaaa
aaagcaaattttattcgtgtttctgttgctggtttacgagagtcacacgtacatgatgtg
aaaattacacgtgaaagtcctaattattccgagacgatatag

DBGET integrated database retrieval system