KEGG   Loxodonta africana (African savanna elephant): 100677133
Entry
100677133         CDS       T04351                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100677133 (AHRR)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100677133 (AHRR)
SSDB
Motif
Pfam: HLH Sporozoite_P67 PAS
Other DBs
NCBI-GeneID: 100677133
NCBI-ProteinID: XP_023397714
Position
Unknown
AA seq 780 aa
MIPPGECLYAGRKRRKPIQKQRPALESEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAVQDTGSRRPVAGDPSSGDGHPSGGSEVLEGRLLLESLN
GFALVVSAEGMIFYASATIVDYLGFHQVKEAKISFQSAKFVIVALENVYCCQGLKIFLIK
LFLSLNFHQIVISTPPPAFFFFPPALVQGVSQGLGSGHGERHRNGLAGVQVCECGVGVSG
VAGMQVSECGVGASGVAGVQVCECGVGASGVAGVQVRDVVNVQDIRNAVPSERCGECPRK
GFTHCKELNECVWLWLSSSLQLDSKTVAVVKSCSPHICNLRVILLLPFLHRAKATPSLCE
SELHGKPSYFAGRSNGENGIPVFRVHADADADRWARAPVRAPCLCVGGTDLVLDPEEAEE
DREEEDHGRMLSGSSGARGQREVHMYNCGFKAAGKMRHLSWTAERHNQGSSVKLEPEPHG
SGPLSVCAKPPGTCVPYPGIQGPFNASGVTAFRSAPSTHPLDHPPSAPCGRTSRPWQDCD
QALVPPPTSCHLPQGVLGNGLPHSRTQRFPMGGYSAEDAELQSAPVPPAALCNPVLSPDV
PIKVENDSGSEDTAEGYTEPPSQVWLGASDLAKRQQVSFPNRMLLKTEPDLPGHLPPCAD
SRQFSYTPHLGPSVSGPHPSCRTTTRPCLCYPAGWACLERTRGLPCPELPHRPLQDPGAR
HPCPLRRDCRVPGAAPVVKREPLDSLSWAKHSQGGVPGMLPKSALAALVPPKVPECRFLP
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgatcccaccaggggagtgtctgtacgcaggaaggaagaggagaaagcccattcagaaa
cagaggcccgccctggagtccgagaagtccaatccttccaagcggcaccgggaccgcctc
aatgccgagctggaccacctggccagcctcctgccgtttccgcctgacatcatctccaaa
ctggacaagctttccgtcctacgcctcagtgtcagttacctcagagtgaagagcttcttc
caagctgtgcaggacacaggctcacggcggccagtggctggggacccctcgtcaggagat
ggccacccgagtggagggtctgaggtgctggagggccggctgctactggagtctctcaac
ggctttgctttagtggtgagtgcagaaggaatgatcttttatgcttcagcaacgattgtg
gactatctgggctttcaccaggtaaaagaagcaaaaatatcttttcagtctgctaaattt
gtaattgttgcccttgaaaatgtttattgttgtcagggtttaaaaatcttcctaattaag
cttttcttatcacttaactttcatcagatagtgatttccacccctcccccagcctttttt
ttttttcccccagccttagtccagggtgtttctcagggtctgggatcaggccatggtgag
aggcacaggaatggcttggcaggcgtgcaggtgtgtgagtgtggtgtgggggtgagtggc
gtggcaggcatgcaggtgtctgagtgtggtgtgggggcgagtggcgtggcaggcgtgcag
gtgtgtgaatgtggtgtgggggcgagtggcgtggcaggtgtgcaggtgagagatgtggtg
aacgtgcaggacattcgaaatgcagtgcccagtgagaggtgcggtgagtgtccaaggaaa
ggctttacacactgtaaagaactaaacgagtgtgtgtggctgtggctgtcttcatctctt
cagctggatagtaagacggtggctgtcgtaaagtcatgtagcccacacatatgcaattta
cgtgttattttgctattaccttttcttcacagggcaaaagctaccccgagtctgtgtgaa
tcagaattgcatggaaagcccagctactttgcagggaggagcaatggagagaacggtatc
ccagtattcagagtgcacgcagacgctgacgccgaccgctgggcccgggctccagtcagg
gccccatgcttgtgtgttggtggcaccgacctcgtccttgaccccgaggaggctgaagag
gacagggaagaagaggaccacgggaggatgctgagcggctcctcgggagcgagggggcag
agggaagtacacatgtacaactgcggcttcaaagcagcggggaagatgaggcatcttagc
tggacagcagagaggcacaaccagggcagcagcgtgaagctggagccagagccccatggc
agcggcccgctctccgtgtgtgccaagcccccaggcacctgtgtcccctacccgggcatc
cagggccctttcaatgccagcggggtcactgctttcagaagtgcacccagcacccacccg
ctggaccatccgccaagtgccccctgtggccggaccagcaggccttggcaggattgcgac
caggccctggtgcccccacccaccagttgccacctcccccagggggtcctggggaatggg
ctccctcactccagaacacagagattccccatggggggctattctgctgaggatgccgaa
ttgcaaagtgcaccagtgcccccagcagctttgtgcaacccagtgttgtcaccggatgtg
cccatcaaagtggaaaacgattctggttccgaggacacagcagagggctacaccgagccc
ccgagccaggtgtggctaggagccagtgacctggccaagagacagcaggtgagttttccc
aacaggatgctcctgaagacagagccggaccttcccgggcacctgcccccctgcgcagac
tccaggcagttctcctacaccccgcaccttgggcccagcgtgtcggggcctcaccccagc
tgcaggaccaccaccagaccctgcctctgctaccctgccggctgggcctgcctggagcgc
acgcgcggccttccctgtccggagctgccccaccgcccactgcaggaccctggcgcgcgc
catccgtgcccgctgcggcgcgactgcagggtgcccggggccgcgcccgtcgtcaagcgc
gaacccctagactcgctgtcgtgggccaagcatagccagggtggggtgccggggatgctc
cccaaaagtgccctggcagcgctggtgccgcccaaagtccccgagtgcaggttcctgccg
tag

DBGET integrated database retrieval system