KEGG   Leptotrichia buccalis: Lebu_0965
Entry
Lebu_0965         CDS       T00975                                 
Name
(GenBank) CagE TrbE VirB component of type IV transporter system
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
lba  Leptotrichia buccalis
Pathway
lba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lba00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lebu_0965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lba02044]
    Lebu_0965
Enzymes [BR:lba01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Lebu_0965
Secretion system [BR:lba02044]
 Type IV secretion system
  Trb secretion system protein
   Lebu_0965
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG FtsK_SpoIIIE WEMBL ABC_tran AAA_10 AAA_22 DUF87 AAA_29
Other DBs
NCBI-ProteinID: ACV38867
UniProt: C7N9N6
Position
complement(1054164..1056647)
AA seq 827 aa
MGKTLNNYKNSFIYHIPWDFLLNDFILVNKNMGFQVTLKVRNHDLDFFTEEEVNLKILQY
NNAIKKLPDNFIVHYEVQRKKSRGYIETEINDNFIPTVLMEKERKDLFSKGEYFKCDYYI
TLTYLIAEDAENKINSLLANKKEDDSEEKMAEEAERELKIFRQKVASFIALLKYATTSIE
VLQGDELMAYMYSTVNAEFPEKKKMPKSSLYPIDQYLSNSSFENGKDTKIQRLTKAKHLR
TISINLFPDDIESRVLKKLESLDFEFRMSARYIILSPNEAKKMLKNFFIFHQGKQKNFGQ
YITEAITKKPSFNIDELELAKTEEAKMALNEFKEGGINYGYYTFTIILADEDLKRIEDNA
LKIVTIFDEQDFTCSIDKYNIFPSYLGAIPGNVKANIRKYPINSMLLSCLFPTSSLYRGE
EVNEFFRDKKNITGVPLMMTKTDLNDIFYFNLHIKDAAHTLIAGPTRSGKSVLLGMITAE
LKKYPNAQVFFFDKGGSIRVLTACMGGKFYDLGKGGDNDLAFQPLANIHIETERAFASNW
IISLLQQENVIVTPDMKSTIWETLTTLSNDPPNRRTMTNFAFTVMNKEIQQALEPYTNTG
SYGKYFDNNEDNFSDSNWQVFEMGRIIEDPKATAPILSYLFHRIEVEKLTKDYLTAIVVD
EAWFAMENESFRLKFNDWLRTLAKLNAFIIFATQSLDEIAKSEITPAIVDGCKTKILLPS
PQAQNYWKDLYSKFGLNSIEIEKVARGEMQKQYFYKSDLGSREFEMDLGKIELAYVGSAS
STDQMKIQEICAETKDLKEINLKWLEYKLGKNSKEFRRCKEIIQGGN
NT seq 2484 nt   +upstreamnt  +downstreamnt
atggggaaaacacttaataactacaaaaattcatttatttatcatatcccttgggacttc
cttctcaatgactttattcttgttaataaaaatatggggtttcaagtaactctcaaagtg
agaaatcacgacttggatttttttactgaggaagaagtgaacttaaaaatattacagtat
aacaacgcaataaagaaacttcctgataattttatcgtacattatgaagtccagagaaaa
aagtccagagggtatattgaaacagagattaacgataactttattccgacagttcttatg
gaaaaggaaagaaaagatttgttttcaaaaggagaatattttaaatgtgattactatata
acattgacgtatttgatagcagaagatgctgaaaataagataaattcattactagcaaat
aaaaaggaagacgattcagaagaaaagatggcggaagaagcagaaagggaattaaaaata
ttcaggcaaaaagtagcctcgttcattgctttattaaaatatgctacaacaagcattgaa
gttttgcaaggagacgaacttatggcatacatgtactccacagtaaatgctgaatttcct
gaaaagaaaaaaatgccgaaatcttctctatatccaattgatcaatatttatcaaattca
agttttgaaaatggaaaagatacaaaaatacaaagattgactaaggcaaaacatttaagg
acaatctcaattaatttatttcctgatgacatagagtcaagagttttaaaaaaacttgaa
agtctggactttgaatttagaatgtcagcaaggtatattattctttcaccaaatgaagca
aaaaagatgttaaaaaacttctttatttttcatcagggaaagcagaagaactttgggcag
tatataacggaagccataactaaaaagccttcatttaatattgatgagctggaactagca
aaaacagaagaggcaaaaatggctttaaatgaatttaaggaaggtggaataaattatggc
tattacacatttaccataatacttgctgatgaagatttaaaaaggattgaggacaatgca
cttaaaatagtaacaatatttgatgaacaggattttacttgctcgattgacaagtacaat
attttcccctcatatttaggggctattccgggaaatgtgaaggcaaatataagaaaatat
ccaataaattcaatgcttttaagctgtctttttcctacttcatcgctgtatcgtggagag
gaagtaaatgaattttttagggataagaaaaatattacaggagttccgcttatgatgact
aaaacagatttgaatgatatattttactttaatcttcatataaaggatgcggcacatacg
ctaatagcaggtccaacaaggtctggaaaatctgtattactaggtatgataacagctgaa
ctaaaaaaatatccaaacgcccaggtattcttttttgataaaggtggttcgatacgtgtc
ttgactgcctgtatgggcggaaaattttatgacttgggaaaaggcggagataatgatttg
gcatttcaaccgcttgcaaatattcatatcgaaacagaaagagcatttgcaagcaactgg
ataatttctcttcttcagcaggaaaatgtaattgtaacgcctgatatgaaaagtacaatc
tgggaaacgcttacgactctttcaaacgatccgcctaacaggagaacaatgacaaatttt
gcatttacagttatgaacaaggaaattcagcaggcacttgagccatacacaaatacaggt
tcatatggaaaatattttgataataatgaggataatttttcagattcaaactggcaagta
tttgaaatgggaagaataatagaagatccaaaagcgacggctcctatattaagctatctg
tttcatagaatagaagtggaaaaattaacaaaggactatttaactgcaatcgtagttgat
gaggcttggtttgcaatggaaaacgaaagtttcaggcttaaatttaatgactggcttaga
acccttgcaaaactgaatgcctttataatctttgcaacacagtcgcttgatgaaattgca
aaatctgaaataacacctgcaatagttgatggatgtaagacaaaaatacttctcccttct
ccacaggcacagaattactggaaagacctttattcaaaatttggcttaaattcaatagaa
attgaaaaagttgcacgaggggaaatgcagaaacaatatttttataaaagtgatcttgga
tcaagagaatttgaaatggatttaggtaaaattgaactagcttatgtaggttctgcaagt
tcgacagatcagatgaaaatacaggaaatatgtgctgaaacaaaggatttaaaagaaata
aatttaaaatggttagaatacaagctgggcaaaaatagcaaagaatttagaagatgcaaa
gaaattatacagggaggtaactaa

DBGET integrated database retrieval system