KEGG   Laccaria bicolor: LACBIDRAFT_291348
Entry
LACBIDRAFT_291348 CDS       T01044                                 

Definition
(RefSeq) NADPH nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
lbc  Laccaria bicolor
Pathway
lbc00910  Nitrogen metabolism
lbc01100  Metabolic pathways
Module
lbc_M00531  Assimilatory nitrate reduction, nitrate => ammonia
lbc_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    LACBIDRAFT_291348
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     LACBIDRAFT_291348
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske_2 Pyr_redox Fer2_BFD NIR_SIR_ferr Rieske Rubredoxin_C NAD_binding_9 AlaDh_PNT_C
Other DBs
NCBI-GeneID: 6082677
NCBI-ProteinID: XP_001887050
JGI: 291348
UniProt: B0DST5
AA seq 1083 aa
MVGIAFIEKLLNLDESNKYFIVTCGEEVHFAYNRVGLTEYFEHRNVSNLYLNPPSWYAEQ
QPDRFRYHLSETVTSISQEAHLVHTSKGRSFRYDKLVLATGSGAGLPPYISQNEVARTRG
VFVYRNISDLDGIISYAAKEGVNHAVVVGGGLLGLEAAKAAYDLETISQVSIINRQAYPL
SRQLDADAGKMVLNKIEAMGVQVLVNCSPSALLTGAADDESGDRTFTGFTLHDGSIFNAD
LVIFAIGIKPRDELAKSSGIECHPRGGVVVGDDLQTSAKDIYAVGECASWKGNYYGLIAP
GIEMADILTFNLTQTESHAPRKMNAPDLSTKLKLMGVDVASFGDYFADKHGSPETPVLAV
ALDNKSKSVDPAKPAIELTTQETSTTVSESRPLASKRGRGADEPIKCLVYNDPFSSTYKK
YIFTADGKHLLGGMMIGDVSDFVKLVAIVKKKKPLDVPPSQFIIGSKKEGADDGNDLDDD
AQVCSCHNVSKGDIVKCVKGGECTDVGILKKKTKVGTGCGGCMPLVTGIYNAEMRKAGHT
LSNNLCPHFNMARVDLFNIIKIKQLRTFAEIMKVVGVNNDSIGCEICKPAIGSILSSLYN
EHVMKPEHHQNQDTNDRYLANIQRNGTFSVVPRIAAGEITPEGLIAIGQVAKKYKLYTKI
TGGQRIDMFGALKSDLPAIWGELNAAGFESGQAYGKSLRTVKSCVGTTWCRYGVGDSVGL
AIQLENRYRGVRSPHKFKGGVSGCIRECAEAQSKDFGVIATDKGWNIFVGGNGGANPRHA
ELFAKDVPPSKVIRIIDRYLAYYIMTADRLQRTARWIESMDGGIEKLRKVILEDELGICT
DLDALMDNLVNSYEDEWAAVVKDPAKRQQFKQFVNTEEQRPQAELIDQRGQMRPADWPKA
TPSTKFSPDQLITPKSEWRWTKVASKRDMMSSENGTTSVAVLYGDTQLAVYHVPKRGYYA
TQQMCPHRRAFVLDHGIVGDTPTGELYVSCPLHKRNFSLTCGKGLSDTEYDILAFQARED
PENENDIQLFLPPKQDIDAVLGTEKWVVRQAESEALELNGTTEIEFVGIKEGSHLCGDPK
LEW
NT seq 3252 nt   +upstreamnt  +downstreamnt
atggtcggaatagctttcattgagaaactcctcaatctcgacgagagcaacaagtacttc
atcgtgacttgcggagaggaggtacacttcgcttacaatcgagttggattaacagagtat
ttcgagcatcgcaacgtgtcaaacctctacctaaacccgccttcctggtacgccgaacaa
caaccagaccgattccgctaccatctctctgaaaccgtcacatccatatcccaggaagct
caccttgttcatacgagcaagggtagatcattccgatacgataagcttgtcctagccacc
ggttccggtgctggtcttccgccatacatatctcaaaacgaagttgctagaactcgagga
gtctttgtgtaccgcaacatctcggacctcgacggcatcatctcatacgcggcgaaagaa
ggagttaaccatgccgtagtggttggtggcgggttgcttgggttggaagctgccaaagcg
gcatatgatctggaaactatatcccaagttagcatcataaaccgccaagcctacccccta
tcgcgtcagttagatgcagacgcggggaagatggtactcaacaagattgaagccatggga
gtccaagtgctcgtcaactgttctccctcggcgctgctcaccggcgccgcagatgatgaa
tcgggagatagaacttttaccgggttcacgctacacgacggatccatcttcaacgctgat
ctagtcatttttgcgataggtatcaaaccccgcgacgagctggcgaagagcagcggcatt
gagtgccaccccagaggcggagttgtcgtcggggacgatcttcagacctccgcaaaggat
atatacgcggtgggcgagtgcgctagctggaagggaaactactatggtttaatcgctccc
ggaattgaaatggctgatatcttgacattcaaccttactcagaccgagtctcatgctcca
aggaagatgaatgccccggatttgagcaccaaactcaaactcatgggagttgatgtcgcc
tccttcggtgattactttgcggataaacacggttctcccgagactccggtactggccgtc
gcccttgacaataaatcaaaatcggtggatccagccaaacccgccattgaacttaccacg
caagaaacaagcacaacggtttcggagtccaggccgcttgcatcgaaacgagggcgtggt
gcggatgaacccatcaaatgcctcgtttacaatgatccattcagctcgacatacaaaaaa
tacatatttactgcggacggtaaacacctgcttgggggtatgatgattggtgatgtcagt
gactttgtgaagctagtggcgatcgtcaaaaagaagaaaccattggacgtacccccttcg
cagtttatcatcggttcaaaaaaggaaggcgctgacgatgggaatgatctcgatgatgat
gctcaagtctgtagttgtcacaacgtctcgaaaggcgatatagtcaaatgcgttaaaggc
ggagaatgcaccgacgttgggatcttgaagaaaaaaacgaaagtcggcacagggtgtggt
ggctgcatgcctctggtcactggcatctacaacgccgagatgagaaaggccggacacact
ctctccaataatctatgcccacatttcaacatggcgcgtgtcgacctattcaatatcata
aaaatcaaacaacttcgaacttttgcagaaataatgaaggtcgtcggggtgaacaatgac
tctatcgggtgcgagatatgcaagcctgcgattggcagcattttatcaagcttatataat
gagcatgtaatgaagcccgagcatcatcaaaaccaggacaccaacgaccggtacttggct
aatattcagagaaatgggacttttagcgttgttccacgtatcgctgcgggggaaatcacc
ccggaaggactcattgctattggccaagtcgcgaagaagtataagttgtataccaagatt
acgggaggccagcgcatcgacatgttcggcgcgttgaaatccgaccttccagccatttgg
ggcgagctcaatgcagccggttttgaaagtggtcaggcgtacggcaagagcctcaggacg
gttaaatcttgcgtcgggactacttggtgccgttatggtgtcggggattccgtcgggttg
gctattcagctggagaaccgatatcgtggggttcgcagccctcataaattcaaaggcggc
gtttctgggtgtatcagggagtgcgcggaagcgcaaagcaaagattttggcgttattgcc
acggataaggggtggaatattttcgtgggtggtaacggcggtgcgaatcctcgacatgca
gagctcttcgcgaaggacgttccaccctcgaaagtgatcaggatcatcgaccgatatctc
gcttattatattatgactgcggatagacttcagcgcaccgccaggtggattgagagcatg
gatggtggcattgagaaacttcgcaaagtaattcttgaggatgagctcgggatatgcacc
gacttggacgcgctcatggataatctggtgaattcatatgaagatgagtgggcagctgtc
gtcaaagaccctgcaaaacgccagcagttcaaacaattcgtcaatacggaagaacaacgt
ccacaagcagagctgatcgatcaacgtggccagatgcgacctgccgactggcccaaggcc
accccctctaccaagttttccccagaccaattaatcacccctaagagcgagtggaggtgg
accaaggtcgcttcaaaaagggacatgatgtcatcggaaaacggaaccaccagcgttgct
gttttatatggtgacacacaactcgccgtttatcatgtccccaaacgagggtattatgct
actcaacaaatgtgcccgcaccgtcgcgcgttcgtcctagaccatggtatcgtcggtgat
acgccgactggtgaactttatgtctcttgcccgctacacaagcggaactttagtctcaca
tgtgggaaaggcttgagcgacaccgagtatgatatccttgcgttccaggcccgcgaggat
cccgaaaacgagaatgatattcaactattccttccgccgaagcaggacattgatgctgtt
cttgggacggaaaagtgggtagtaaggcaggctgagtcagaggcccttgagttgaacgga
acgacggaaattgagttcgttggaatcaaagaaggtagccacctatgcggagaccctaaa
ttagagtggtag

DBGET integrated database retrieval system