KEGG   Lactobacillus casei BL23: LCABL_04250Help
Entry
LCABL_04250       CDS       T00723                                 

Gene name
sorA
Definition
(GenBank) EIIA sorbose-PTS homolog
  KO
K02812  sorbose PTS system EIIA component [EC:2.7.1.206]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00051  Fructose and mannose metabolism
lcb01100  Metabolic pathways
lcb02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LCABL_04250 (sorA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LCABL_04250 (sorA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcb02000]
    LCABL_04250 (sorA)
Enzymes [BR:lcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     LCABL_04250 (sorA)
Transporters [BR:lcb02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    LCABL_04250 (sorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man DUF1445
Motif
Other DBs
NCBI-ProteinID: CAQ65551
Position
424591..425007
Genome map
AA seq 138 aa AA seqDB search
MEIILVGHAHTAKAFKEAVEMIYGEVPNFHPIDFTPKEGLQSLTDKIVSAIEPGKTASTL
IITDLFSGTPYNASAELVLKKKAADVVAGMCLPMLLEVAVNANNMSVSQLVSHLMKIKEE
FSTSLSEKMTTNAKEDDF
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaaataattttagttgggcatgcacatactgctaaggcttttaaagaagcggtagag
atgatttatggtgaggtgccaaatttccatccaatagatttcacgccaaaagaagggttg
caatcgctgacagacaaaattgtttcggcaattgaacctggtaaaacggcaagcacttta
atcattactgatctattctcgggaacaccctacaatgcgtcagcagaattagttttgaaa
aagaaagcggcggatgttgttgcgggaatgtgtttgccaatgctattggaggtcgcagtt
aacgcaaataatatgagcgttagccaactggtttcacacttgatgaaaatcaaagaagag
ttttcaacgagccttagcgagaaaatgacaacgaatgcaaaggaggacgatttctga

DBGET integrated database retrieval system