KEGG   Lates calcarifer (barramundi perch): 108903096
Entry
108903096         CDS       T04895                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcf03036]
    108903096 (ankrd53)
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    108903096 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank_4 Ank Ank_5
Other DBs
NCBI-GeneID: 108903096
NCBI-ProteinID: XP_018560710
UniProt: A0A4W6D7K7
Position
Unknown
AA seq 396 aa
MEPVNKSGKGSRGRCKNRKLSRRAPPDGRRLPAVVVGTTRRLDVGVNRQGLPALHVACLY
GQMATVQLLVESTLDWMDISDPQGRRPIHMVMSSQSSPNTSACLRYLLEKGADINVTTDS
GQTPLHLAASEGLLDCVEILLQAGADVFAHDSMGHTPLDLACIWCRRKVARYLKNCIWKL
EKKRELEERKLVQALYSDLVDMVKLYNVSKRTLIDEKMAEWANKKGLPHLRDFSPRVVVS
KYHTQCLSSDQGSSNVKHAKHQPSDPREDQEITSSKLPPAPAPRPWSIYMGLQPEKPPAV
PDLRDSVTVWRDGSSRKPQYNTKWDGTPHDAPDLPLDVLERALFPRAFPSRIVSPRHFEP
QDIVEVQRRGCPQGRSTSPWTEVAMHLAEVLEPGHY
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggaacctgtcaacaaatccggaaaagggagtcgtggtagatgtaaaaaccggaaactc
tcccgcagagctcccccagacggccgcaggttgcccgctgtagttgttgggaccacacgg
aggctggacgtcggtgtgaacaggcagggtttgccagcgctccacgtggcctgcctctac
ggccagatggctactgtccagctcttggtggagtccacgctggactggatggacatcagt
gatcctcagggtcggcggcccattcacatggtcatgtcctcccagagctcgcccaacacc
tcggcctgtctcagatatctgctggagaaaggagctgacattaatgttaccacagactca
gggcagaccccgctgcacctggctgcctctgaaggcctcctggactgcgtggagatcctc
ctgcaggccggtgcagatgtgtttgcccacgacagcatgggacacacgcctctggatttg
gcctgcatctggtgccgcagaaaggtcgcgaggtatctgaaaaactgcatatggaagtta
gaaaagaagagagaactggaggagaggaagctagttcaagctttatacagtgatcttgtg
gacatggtcaaactgtataatgtcagcaaaaggacacttatagatgagaagatggcagag
tgggcgaacaagaaaggtttgccccacctgagggatttctcccccagagtcgtggtgagc
aagtaccacacccagtgcctctcatcagatcagggcagctctaatgtaaaacatgccaag
caccagccaagtgacccccgggaggatcaggagatcacctcctcaaagctacctccagca
ccagcccccaggccctggagcatctacatgggcctccagccagagaaaccccccgcggtg
cctgacctccgggacagcgtcacagtgtggagagacggcagcagcaggaagcctcagtac
aacaccaagtgggacggcacacctcatgatgcccctgacctgcctctggatgtccttgag
agggcgttgttccccagagccttcccttccaggatcgtctcccctcggcactttgagcca
caggacattgtggaggtccagcgcagaggatgcccccaggggcggagcacctccccctgg
acagaggtggccatgcatctggctgaggtgctggagcctggacattactga

DBGET integrated database retrieval system