KEGG   Latimeria chalumnae (coelacanth): 106702803
Entry
106702803         CDS       T02913                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04080  Neuroactive ligand-receptor interaction
lcm04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106702803 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106702803 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 106702803
NCBI-ProteinID: XP_014341585
Position
Un
AA seq 77 aa
MNCKSLLFGVLFLFLTLTSVWGGPLAIPLEGSDLEEGSLKNLVQQSIVRNNSGHRQSGWR
RYRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaactgcaagtccctcctgtttggggttttgttcctcttcctaaccctaacttctgtc
tggggaggacctctggctatcccgttagaagggagcgatctggaggaaggaagcctaaag
aacctggtgcagcagagcatagtacggaacaactcggggcaccgacagtcaggctggaga
agatacaggcgccccaggccacgtctctcccacaaggggccgatgcctttttaa

DBGET integrated database retrieval system