KEGG   Larimichthys crocea (large yellow croaker): 104936962
Entry
104936962         CDS       T04659                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lco03036]
    104936962 (ankrd53)
Chromosome and associated proteins [BR:lco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    104936962 (ankrd53)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 104936962
NCBI-ProteinID: XP_010751367
Position
I
AA seq 389 aa
METVNKAGKSSRRRGRRKNCELTHRAPPGGQMFPAVGSLEKLDVSVNTQGESALHMACLH
GHLATVHLLLESRPSWINSSDHQGLRPVHMVLTSQSSPNTSACLRYLLEHGADVNATTDS
GTTPLHLAASEGFLDCTEILVRAGADVSAQDNGGCTPLDLARIWCHRKVARFLKNCTWQE
DKTKEMQERMLGQALYRDLVDMKLNDPVKKTLTDVRMEQWASKKGLPLLKNFSPRVLVSR
YHTQCLQSDENTSNLKHPKHQAAGPQEDKSTSVKQPPALKPWAIFMPEKPSIVLDLRDSV
TVWRDSSSRQPQYNTKWDTRPCLAPDLSLDVLERVLFPREFPSRIPSPRYFEPQDIVEVQ
RRGYPQGRRTSPWTEVAMHLAEVLEPGHY
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggagactgtcaacaaagccggtaagagcagcaggagacgagggagacgtaaaaactgt
gaactcacccacagggctcctccaggaggacagatgtttccagctgttgggagtctggag
aagctggatgtcagtgtgaacacacagggtgagtcagcgctccacatggcctgtctccat
ggccacctggctacagttcacctcctgctggagtcgaggccgagctggatcaacagcagc
gatcaccagggtctccgacctgttcacatggtcctgacctcccagagctcacccaacacc
tcggcgtgcctcagatacctgctggagcacggggccgacgtcaacgccaccacagattca
gggacgacgccgctgcacctggctgcctctgaaggtttcctggactgcacggagatcctt
gtacgagctggagcagatgtttcggcccaggataacgggggatgcactcctctggattta
gcccgcatttggtgccacaggaaggtggcgaggttcctgaaaaactgcacgtggcaggaa
gataagacgaaagaaatgcaggagaggatgctgggtcaagccttatacagggatcttgtc
gatatgaaactgaacgatcctgttaaaaagacacttaccgatgtgaggatggaacagtgg
gcaagcaagaaaggtcttcccctcctgaagaacttctcccccagagtcttggtgagtcgg
taccacacccagtgcctccaatcagacgagaacacttcaaatctaaagcatcccaagcac
caagcggcaggccctcaagaggacaagagcacctccgtcaagcaacctccagccttgaaa
ccctgggccatctttatgccggagaagccctccatcgtgctggacctccgggacagcgtc
acggtgtggagggacagcagcagcaggcagcctcagtacaacacaaagtgggacactagg
ccttgcctcgcccctgacctgtctctggatgtcctcgagagggtgttgttccccagagag
ttcccttcgaggatcccgtcccctcgctactttgagccgcaggacattgtggaggtccag
cgcagaggatacccccaggggcggaggacgtccccctggacagaggtggccatgcacctg
gctgaggtgctagaacccggacactactga

DBGET integrated database retrieval system