KEGG   Lactobacillus fermentum IFO 3956: LAF_1253Help
Entry
LAF_1253          CDS       T00699                                 

Definition
(GenBank) flavoprotein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00770  Pantothenate and CoA biosynthesis
lfe01100  Metabolic pathways
Module
lfe_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lfe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LAF_1253
Enzymes [BR:lfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     LAF_1253
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     LAF_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_10 APS_kinase YjeF_N
Motif
Other DBs
NCBI-ProteinID: BAG27589
UniProt: B2GD57
Position
complement(1441835..1443064)
Genome map
AA seq 409 aa AA seqDB search
MARIAVYLTGSIAAYKAVSVVRELQRAGHEVRVAQTKAAEQFVGPATLASLTHHPVVDDL
WEMSEEGQIPHVHLADWSDLALVVPASADVIAKMAAGLADDAVTSALLATQAPRLVVPAM
NSHMWQNPATQRNVTQLLADGVHFLEPADGMLAEGYTGMGRMPEVSTIIAWVAEFLTTGN
ALAGKRLVVTAGGTREPLDPVRFIGNRSSGKMGIAIAKAAANQGAQVELIVGSVSVDLPN
DAGITVRQVETTEELLAAVDQAFEGADALVMAAAVADFRMEAVSDQKIKKDAHGELILKL
VKTPDILKTMGQKKGHRLVVGFAAETTALVENGMAELKKKNADLIVANDVTKVGSGFGAD
TNQVTILAVDQAPQTWPKLSKAAVAKRLVALIGQRLGGKTNGGTRSSHS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggattgcggtatacctaacgggaagcattgcggcttataaggcagtaagcgtg
gtgcgggagcttcagcgcgctggtcacgaggtgcgggtggcccaaacaaaagcggcggag
cagtttgttggtcccgccaccctggcttctttgacgcaccacccggtcgttgatgacctc
tgggaaatgagcgaagaggggcaaatccctcacgttcacttagccgactggtccgacttg
gccttggtggtgccggctagtgcggatgtaattgctaagatggcggcggggctggctgat
gatgcggtcaccagcgccctgttagcgacccaggccccgcgtctggtggtgccggccatg
aattcacacatgtggcaaaacccagctacgcaacgaaacgttacccaactgctggctgat
ggggttcacttcttggaacccgccgatgggatgttggcggagggttacaccggcatggga
cggatgcccgaggttagcaccattatcgcttgggttgcggagtttttaaccaccggaaac
gccttagcgggtaagcgcttggtggtgacggcggggggaacccgcgagccactggatccg
gttcgctttatcggcaaccgttcctccggtaagatgggaattgcgattgcaaaagcagct
gctaaccagggggcccaggtggaattgattgttggcagcgtgagtgtcgacttgccaaac
gacgctggaatcactgttcgccaagttgaaaccaccgaggagttgttggcggccgttgat
caggcttttgaaggggcggacgccctcgtaatggcggcggcggtggccgactttcgcatg
gaagcggtcagtgaccaaaagatcaaaaaggatgcccacggggagctgatcctgaaactg
gtgaagaccccggatattttgaagacaatggggcaaaagaaggggcaccgcctggtggtg
gggtttgccgccgaaacaaccgccctggtcgaaaacggcatggcggagttaaagaagaaa
aacgccgatttgatcgtagctaatgacgtgaccaaggtgggcagtggctttggggccgat
accaaccaggtcaccattttggcggtcgatcaggcaccccagacttggcccaagcttagt
aaagcggcggtggcaaagcgactggtagcgctgattggtcaacgattgggggggaaaaca
aatggcggaactcgttcaagtcatagttga

DBGET integrated database retrieval system