KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_232824
Entry
LOTGIDRAFT_232824 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
lgi  Lottia gigantea (owl limpet)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lgi03036]
    LOTGIDRAFT_232824
Chromosome and associated proteins [BR:lgi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    LOTGIDRAFT_232824
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3 ArsC
Other DBs
NCBI-GeneID: 20249056
NCBI-ProteinID: XP_009056283
JGI: 232824
UniProt: V4AI36
Position
Unknown
AA seq 558 aa
MSSAVEQTDKSHTSSSQTGASSAKNGQSTRRRRTRMVNEKKIADDEFMAAAIGDVEWLKQ
SLKDSGSISNFDKNGLTAFHLAAIHGRLDCLKLCVEKFKFDINQASSTGWRPVHLVISNQ
TGKRALQCLKYLLEKGANPSVTNDDLITPVHQSASEGHVQCLKLLIENGACVNSKDCRGN
TPLDLSKLWSHRKCGRILAAEIWHQEKDHVAMEMNQLQKVKMQQVLKDLEEEEERHTSQE
FYGQQAFKDWLASRNLEERPTGPTGRKTEMDYNYDESARETNSPDKHPLMKPNSKAPPRS
NSQLRTPTSREPTQSPGKEKTSMSLKRDPTYNTEYTFEFEEDDDENFDGQGNKPQVAGSP
EKRTKSKLILAKHDSPWTLTTATNVPKPEYLPHLKDEYPRDEFTLMPKTKPEQKYYDGKH
AGPKELKKEKSASAKARAIDLPKDVQDKVLSRDPSILERPILFKPKHVIDLPTKKKLEEE
VKPRDEVSLHLCSDVSSILFKNSLKMKPPSSAKSSSSGLSKATDWTSEDFPSAMVAQAMK
QMAKSNYFPKTSGSGIKI
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtcgtctgctgttgaacagactgataaatctcacacatcaagctcccagaccggagca
tcttcggctaaaaatggacaatcaactcgacgacggagaacacggatggtgaatgaaaaa
aagatagccgacgacgagtttatggctgcagctataggtgatgtagaatggctaaagcag
agtctaaaggacagtgggtccatatccaattttgataagaatggattaacagcatttcac
ctagctgctatacatggccgtttagattgtctcaaactgtgtgtagaaaagtttaagttt
gatattaatcaagccagttctacaggttggagaccagttcacttggtaatcagtaatcaa
actggaaaaagagctttacagtgtttaaaatatttgttagagaaaggtgccaacccatct
gtaactaatgatgaccttataaccccagtccaccaatcagctagtgaaggtcacgttcag
tgtttaaagttattaatagaaaatggggcttgtgttaatagcaaggattgccgtggaaat
acaccattagatctatctaaactttggagtcatagaaaatgtggcagaattctggcagca
gaaatttggcaccaagaaaaagaccatgttgccatggaaatgaatcagttacagaaggta
aagatgcaacaagtactgaaagaccttgaagaagaagaagaacgacatacttctcaggag
ttttatggacaacaggctttcaaagactggctagcttctagaaacctagaagagagacct
actggacctactggtaggaagacagaaatggactataattatgacgaaagtgcaagagag
accaatagccccgacaaacatcccttgatgaaaccaaatagtaaggccccaccaagatca
aatagtcagctccgcacaccaacaagtcgtgagccaactcaaagtccaggtaaagaaaag
acgtctatgtctttaaaacgggatccaacctacaacacagagtatacttttgagtttgaa
gaagatgacgatgaaaattttgatggacaaggaaacaaacctcaggttgcaggttctccg
gagaaacgtacaaagagcaagttgatcctggccaaacatgacagtccatggacacttaca
acagctaccaatgtacccaaacctgaatatttgcctcaccttaaagatgaatatccgcgc
gatgaattcacattaatgccaaaaacaaaacctgagcagaaatattatgatggtaaacat
gctggacctaaagaactgaagaaagaaaaatctgcctcagccaaggccagagcaattgac
cttcccaaagatgtacaagacaaggttctgtcacgagatccatccattcttgaacgacca
atattatttaaacccaaacacgtcattgacttaccaactaagaaaaaactggaagaggaa
gttaaacccagagatgaggtatcattacatctttgtagtgatgtgtcatccattttgttt
aagaacagtttaaaaatgaaaccaccatcttctgctaaaagcagttcatctggtctcagt
aaagctactgattggaccagtgaagatttcccttctgcaatggtggctcaagcgatgaaa
cagatggcaaagtcaaattattttcctaaaacaagtggttcaggtattaaaatctaa

DBGET integrated database retrieval system