KEGG   Leuconostoc mesenteroides KFRI-MG: LMES_0747Help
Entry
LMES_0747         CDS       T02997                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
lmk  Leuconostoc mesenteroides KFRI-MG
Pathway
lmk00740  Riboflavin metabolism
lmk00790  Folate biosynthesis
lmk01100  Metabolic pathways
lmk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    LMES_0747
   00790 Folate biosynthesis
    LMES_0747
Enzymes [BR:lmk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     LMES_0747
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     LMES_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AHF18963
Position
803743..804936
Genome map
AA seq 397 aa AA seqDB search
MTSTTEKVKTAVKELKKGKLIILSDDKKREHEGDLVGLASFVTAATVNEALSIARGVLAV
PITKSRADELGLDQMTTHNSEKFGTKFTVSVDHIDSTTGVSAYERAATIKNLANLSTTSV
DFETPGHIFPLVAEDGGVLTRQGHTEGAVELAKIAGVPPVAYIIEILAQDGTMAREKELK
ELAKKHDIFQLSMQDLINYREDQKQAGIDEGPTVYLPTQYGDFHLTEFSVNDEEKSDLLI
QSSRSFDQIPLVRLHSECLTGEIFGSQRCECGPQLREALKTINKQGGALVYLRQEGRGIG
LHEKLKSYVLQENKFDTYDANVHLGHLPDERDYKKAAKILKISGLTKIRLLTNNPDKVQS
LIDEGIEVIEQVPLITGINDKNEQYMQTKKEKFNHKL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtactacagaaaaagttaaaacagcagttaaagagttgaaaaagggtaagctg
attattttgagcgatgacaaaaaaagagaacatgaaggagatttggtcggtttagcatca
tttgtgacggcagctacggtcaatgaagccctttcaattgcaaggggtgttctagctgta
ccaatcactaaatctcgtgctgatgaactcgggttagaccaaatgacgacgcataattct
gaaaaatttgggacaaagttcactgtgagcgttgatcatattgacagcacgacgggtgtt
tctgcgtatgaacgtgctgccacaatcaaaaatttagctaatctaagtacaacatctgtt
gactttgagacgcctggtcatattttcccattagtcgctgaagatggtggcgtactgaca
agacagggacatacagaaggggctgttgagttagctaaaatagctggtgtgccgcctgtg
gcgtatataatagaaattttggcacaagacggaacaatggctcgagaaaaagaacttaaa
gaattagcgaaaaaacacgatatatttcaattatcaatgcaggatctaattaattaccga
gaagaccaaaaacaagcaggtattgacgagggaccaacggtatatttaccaactcaatac
ggtgattttcatttgacggagtttagcgtgaatgatgaagaaaaatctgatttgcttatt
caaagcagtcgtagttttgatcaaattcccttagttcgcttacactccgagtgtttaacc
ggcgaaatatttggttcacaacgttgtgaatgcggtcctcaactgagagaagcgctcaaa
acaataaataagcaaggtggggctcttgtttatcttcgtcaagaaggtcgtggtattgga
ctccatgaaaaactaaaaagttatgtgttgcaagaaaataagtttgatacgtatgatgcg
aatgttcacttagggcatttgccggatgaacgggactataaaaaggctgccaaaattttg
aaaatatcaggattaaccaaaattcgcttattaacgaataatccggataaagtacagtcg
ttaattgacgaaggtattgaggttattgaacaggtacccttaattacgggcattaatgat
aagaatgaacaatatatgcaaacaaaaaaggaaaaatttaatcacaagctgtga

DBGET integrated database retrieval system