KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0228Help
Entry
LMOSLCC2479_0228  CDS       T02241                                 

Definition
(GenBank) dihydrouridine synthase
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus His_biosynth NanE Oxidored_FMN FMN_dh SOR_SNZ PEP_mutase MR_MLE_C HEPN_SAV_6107 ThiG G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: CBY56499
Position
234379..235374
Genome map
AA seq 331 aa AA seqDB search
MFKIGNVEIKNQVVVAPMAGISNSAFRLTVKEFGAGLVCCEMISDKGIAYRNAKTLDMLY
IDEKEKPLSLQIFGGEKETLVEAAKFVAENTTADIIDINMGCPVNKIIKCEAGAKWLLDP
NKVYDMVAAVVDAVDKPVTVKMRIGWDEEHVFAIENALAAERAGAAAVAMHGRTRVQMYE
GSANWDVLRDVKRELKIPFMANGDVRTPEDAKRILEHTGADGVMIGRAALGNPWMIYRTV
KFLETGELLLEPEPREKMQTAMLHLNRLVELKGENIAVREFRQHAAYYLKGARGSTRAKV
AANQATKQSEMEAILNEFVLQYEEKALAKQD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaataggtaacgtagaaattaagaaccaagtagttgtggcgccgatggcaggt
atatccaattccgcatttcgtctaacagtcaaagaattcggagcaggcctcgtttgctgt
gaaatgattagcgacaaaggaatagcataccgcaatgctaaaacacttgatatgctatat
attgatgaaaaagaaaaaccactgagtctgcaaattttcggcggcgagaaagaaacgctt
gtagaagctgcgaaattcgtagctgaaaacacaacggcagatattattgatattaatatg
ggctgcccggtaaacaaaattatcaaatgtgaagctggagcaaaatggctacttgatcca
aataaagtgtatgacatggtagctgctgtagtggacgctgttgataaaccagttacggta
aaaatgcgtattggctgggacgaagaacatgtctttgctatcgaaaatgcacttgctgct
gaacgtgccggagctgcagctgttgcaatgcacggccgtactcgtgtgcaaatgtacgaa
ggtagtgcgaactgggatgtactaagagacgtaaaacgcgaactgaaaatcccgttcatg
gcaaatggggacgtgagaaccccagaagatgccaaacgaattttagaacatactggagca
gatggagtaatgattggtcgagctgcacttggaaatccgtggatgatttatcgcacggtg
aaattcctagaaacaggcgaacttctcctagaaccagaaccacgcgaaaaaatgcaaact
gccatgctacacctaaaccgcttagtcgagttaaaaggagaaaacattgcagttcgtgaa
tttagacaacacgcagcttattatctaaaaggagctcgcggaagcactcgcgcgaaagtg
gctgctaaccaagcgacaaaacaatcagagatggaagcaattttaaatgaatttgttctt
caatatgaagaaaaagcattagcgaaacaagactaa

DBGET integrated database retrieval system