KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0266Help
Entry
LMOSLCC2479_0266  CDS       T02241                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 MarR HTH_34 HTH_27 HTH_24 HTH_Crp_2 SgrR_N HTH_IclR Fe_dep_repress DUF3116 DUF4364 HTH_20 B-block_TFIIIC PadR TrmB Rrf2 DUF4423 HTH_5 HTH_11 HTH_37 HTH_36
Motif
Other DBs
NCBI-ProteinID: CBY56537
Position
289106..289522
Genome map
AA seq 138 aa AA seqDB search
MVKKEERLGVLLWFRFSRFYNRNMKLTNQNLRAAGISTAQFDCIAQIGLDKEITQQQLAE
KLVVTKGNVTQLLAKLEQLGYITRTKTGREKHITLTEKGQACYRENVPKQEAFQQAQFDK
LTRDEQKELLKLLKKLGE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaagaagagaggctaggggttttgctttggtttcgatttagtcgtttttat
aatcgaaatatgaagctgaccaatcagaatttgcgagcagcagggatttcaacggcgcag
tttgattgcattgcccaaattggcttagacaaagagattacacagcaacaacttgccgaa
aaattagtcgtaacaaagggaaatgtcacccaactcctcgcaaaattagagcaattaggt
tatattacgcgaacaaaaacaggacgcgagaagcatattaccctcacagaaaaaggtcaa
gcatgttaccgagaaaatgtcccaaaacaagaagcttttcagcaagctcaatttgataaa
ttaacaagagacgaacaaaaagaactacttaagctattaaaaaaattaggagagtga

DBGET integrated database retrieval system