KEGG   Legionella pneumophila Corby: LPC_1874
Entry
LPC_1874          CDS       T00532                                 

Definition
(GenBank) Type IV secretory protein VirB4 component
Organism
lpc  Legionella pneumophila Corby
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF87 AAA_10
Other DBs
NCBI-ProteinID: ABQ55806
Position
2817233..2820007
AA seq 924 aa
MKLFSQVSDWLLGQPNKPALTQQNIKKRFENHNPSFANQLSMVDFNDELNLFLLNDGVSI
GSGFELASIPAEATSTEHLHAVFSKIRDTFATVVPLHKEDPWVMQMYVNDEYSLKPVLTH
IQQSIAPDIAETSFSRDYLARLDDLFCKMTRPEGLFVDPKTDAPYRGRRRRIRVLFYRLY
QKTQTTRELALAEHQEVMAQIESKLLSPGLQLKQLTGKDYYQWLVRWFAANPEELLARFP
YPKDKKPAGYTLSQNILFHEPQSDEHGFIFDEMIHRILYIDGLKEAPEIGLLSREKPQAN
PKHRYALLDKLPEDATYTIQVVFENDEALDAHLLRLEKGIVGTSLKPSQVREDIKTARDE
LSIGNRLFWVNQSIFYRASTKDQAVRIEKELKELFIEAKMPLISSGFDIHPINSYLNALP
FNFIPQYARQYLRFDRLMYASELASLLPVYGRNQGARHLPCFTFFNRLGEPVLFDVLHHD
FISQNSHMALFANSGGGKSVATGWMINSLMATKNARIILFEMGNSFDRMLLHAKAHGKKT
KQLLLSNKKNEAVPLNPFCEAYKAIHEITDNLNVEQAALIAQKIMTLKANLEQPANSEDL
SCDDGSRSYLAELALALRTMITEANALEEEQFTLADETLLIEVLSDAILTSFNHDIPQML
TEHVVSAFKRRLDKETVARKKDRILDMHDRLNSYVINSAKSRFFNVPTEPLGDFDIFHVD
ISAIKDDTGKLALVMVSLLPRILAMAEASQNDHRPTFLFIDESHLQFQIPSVVAVCLLVA
KVARKLGLWLVAITQNVTDMNSEKATKILSLIETWILLGLDEKEISDVKRFKSLTPQQEA
LIRDIDSQKGLYAEAVLLGSRYQGLFRVIPPRYLLALLMTEKSEKAQRHTLEKQHDVLKA
AELLAEQLENKKQSKKHDAYFYDD
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgaaattattcagccaagtaagtgactggctgttaggacaacccaataaaccagcatta
acgcaacaaaacataaaaaaaagatttgagaatcacaacccttcctttgccaatcaattg
tctatggtggatttcaatgatgaactcaatctctttttactcaatgatggagtcagcatt
ggctcaggttttgaattagcctccattccagcagaagctacatctactgaacatttacac
gctgtatttagcaaaattcgagatacttttgccacagtcgtacctttgcataaagaagat
ccttgggtaatgcaaatgtatgtcaatgacgaatacagtttaaaacctgttctcacccat
attcaacaaagcattgcaccggacattgctgaaacatccttttctcgtgactatttggca
aggttggatgatctgttttgcaagatgacaagacccgaaggattgtttgttgatccaaaa
accgatgcaccctatcgcggcagacgaagacgaatcagggttttgttttatcgcctctat
caaaaaacgcaaaccactagagagctggcacttgccgagcatcaggaagtcatggctcag
attgaaagcaaattactatcacctggtcttcaactaaaacaactaaccggtaaagattat
tatcagtggttggtgcgttggtttgcagccaaccccgaagaactattagctcgttttcct
taccctaaagacaaaaaaccagcaggctataccttaagccagaatattttgtttcatgaa
ccacaaagtgatgagcatgggtttatatttgatgagatgattcatcgcattctttatatc
gatggtctgaaagaagcacctgaaattggtcttttatctcgtgaaaaaccacaagccaat
cccaaacaccgatacgcacttttagataagttgccagaagatgctacctatactattcag
gttgtctttgaaaatgatgaagccttagatgcgcatctgcttcgtcttgaaaaaggcatc
gtaggaacaagccttaaaccgtcacaagtcagagaggatatcaaaactgcacgagatgaa
ttgtctataggaaaccgcctgttttgggttaatcaatctattttttatcgtgccagtacg
aaagaccaagcagtacgcattgaaaaagagctaaaagaattatttattgaagccaaaatg
cctttgatttcttctggtttcgacattcatcccatcaacagttatctcaatgccttacct
tttaatttcatcccgcaatacgctcgccaatatttgcgctttgaccgattgatgtatgca
tccgaattagcctctttactgcccgtgtatggacgcaaccagggagcaagacaccttccc
tgtttcaccttttttaaccgtttgggagaaccagtactctttgatgtgttgcatcatgat
tttatcagccaaaactcccacatggccttattcgccaattccggtggcggcaaatcagtg
gctactggctggatgattaattcgttgatggccactaaaaatgcccgcatcattcttttt
gaaatgggtaattcttttgatcgtatgctccttcatgccaaagcgcatggcaaaaaaaca
aagcagttattacttagcaataagaaaaatgaagctgttccattaaatcctttttgtgag
gcctataaagccattcatgaaataacagacaatttaaatgtagagcaggcagctctaatc
gcgcaaaaaatcatgacactcaaagcaaatctcgaacagcctgccaattcggaagattta
tcctgtgatgatggatctcgatcgtatctggcagaactggctttggcattgcgtaccatg
attactgaagccaatgcgttggaagaagaacaatttaccttagcagatgaaacattgtta
attgaagtattaagtgatgccatcttaacgtcttttaaccatgatataccgcaaatgctg
actgaacatgtcgtgagtgcttttaaacgacgattggataaagaaacggtagctcgcaag
aaagatcgcattttagatatgcacgaccgattaaacagttatgttattaacagcgccaaa
tcacgcttttttaatgttccaactgaacctttaggagattttgatatctttcatgttgat
atctccgcgattaaagatgataccgggaagctcgctttagtgatggtgtctttattacca
agaatattggctatggcagaagccagtcaaaacgaccacagaccaacctttctttttatt
gatgaatctcatttgcaatttcaaattccttcagtggtggccgtatgtttactggttgcc
aaagtagccagaaagttaggtctttggctggttgctattacccaaaacgtcaccgatatg
aattcggaaaaagccaccaagattttatcgttaattgaaacctggattttattaggtctt
gacgagaaggaaattagcgatgtcaaacgctttaaatcattaactccgcaacaagaagcc
ttaattagagatattgattcacaaaaaggcttatatgcagaagcggttttattaggctca
cgttatcaaggattatttcgtgtcattccacctcgctacttacttgctcttttaatgact
gaaaaatcagaaaaagcacagcgccataccctggagaaacaacatgatgtccttaaagcc
gctgaattacttgcagaacaactcgagaataaaaaacaaagcaaaaaacatgatgcttat
ttctatgatgattag

DBGET integrated database retrieval system