KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0989
Entry
lpg0989           CDS       T00199                                 
Name
(GenBank) Type IV secretory protein VirB4 components
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB
Motif
Pfam: TraC_F_IV DUF87 P-loop_TraG AAA_10 FtsK_SpoIIIE NADH_B2
Other DBs
NCBI-ProteinID: AAU27075
Pasteur: lpg0989
UniProt: Q5ZWU6
Position
complement(1082487..1085240)
AA seq 917 aa
MMKRLSNWLLGEKNPQAIKEQEVKMQYANPLPSFADRLAIVDFNEKEQVFLFADGKSLGS
GFELGDIQAEAASPEYLQAVFNKIRDTFATVVPLHAIDPWVMQIFVQDEYSLDPVIDHIK
AQIPQQLIESPLTQDYLQRLHDLYNKMTRPEGLFLDPKTGAPYRGRRRRIRVLFYRQLHQ
TTLTREQTLLEHQEVVSQIETKLRSPGLEIKRLKGQDYYQWWIRWFNPKSADEILEQYPY
PDPIPAGFNLAQNIFFSPPESDEQGFIFEGRKQRVLYVDGLKESPIIGLVSRERQQANPK
HRYALLDTLPEGSIYTIQVVFSHDESLDSHLTRLEKGIVGTSLKPQEVRDDIKTARNELS
TGNRLFWVNQAVFYQAEDEQQAQAIEKNLHTIFNDAKMPLIHSSYDIHPLNSWLNALPFN
FDPHYARKYLCFDRLMYATELAALLPVYGRNQGARHLPCFPFFNRLGEPVFFDLLHHDFI
SQNSHCAIFANSGGGKSVLTGWMIQSLLAMKNARVVLFEMGNSFDRMLIHAKAHGKKTKQ
LLLSNKKEEAVPLNPFCEAYKAIPEITDNLSAEQASLMAQKILDLKDPANSEDLACGDGS
RAYLAELALALRTMITEANALEEEQFTLADETLLIEVLIDAILTSFNNGIPQMLTEHIVS
SFKRRLDKETVTRKKDRILDMHDRLNSYVINSAKSRFFNVPTEPLGDFDIFHIDISAIKD
DTGKLALVMVSLLPRILAMAEATQNDNRPTFLFIDESHLQFQIPSVVTVCLLVAKVARKL
GLWLVAITQNVTDMNSEKAAKILSLIETWILLGLDEKEITDVKRFKSLTPQQETLIRDID
SQKGLYAEAVLLGSRYQGLFRVIPPRYLLALLMTEKSEKAQRHLLEKEHDVLEAAEIMAK
KLEQPKTTTHNRAYFYD
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgatgaaacgattatctaactggttgcttggggaaaagaatccccaagctataaaggaa
caagaggtaaaaatgcaatacgccaaccctctcccatcttttgccgacaggctcgccatt
gttgattttaatgaaaaggaacaagtatttttatttgctgatggaaaaagtttaggttca
gggtttgagttaggcgatattcaagctgaagccgcttctcctgaatatcttcaagctgtc
tttaataaaatccgcgatacctttgcaacggtagttccccttcatgccattgatccttgg
gtcatgcagatatttgttcaagatgaatatagccttgatcctgtaatcgatcatattaaa
gcccagattccacaacaactcattgaaagtccattaacgcaagactacttacaacgcctg
cacgatctctacaataaaatgaccaggccagaaggcttatttctcgatcctaaaacgggt
gcgccctatcgtggccgcagacgaagaatcagagtattgttttatagacaactacatcaa
accactttaactagagaacagactcttctggaacatcaagaagtcgtcagccagattgaa
accaaattgcgctcaccaggcctagaaatcaaacgtcttaaaggtcaggattattatcaa
tggtggatacgctggtttaatcccaaatcagccgatgagatcttggaacaatatccctac
cctgaccccataccagcaggttttaatctggcgcaaaatatattcttttccccgcctgag
agcgatgaacaaggatttatttttgaaggccgaaaacaaagagttctgtatgttgatggc
ttaaaagaatcgcctattattggtttagtctcccgagaaagacaacaagccaatcctaaa
caccgctatgcgcttttggataccttgccagaaggaagcatctacaccattcaagtcgtc
tttagccatgatgaaagtcttgattcccatttaacacgattagaaaaaggaattgtggga
accagtttaaaaccacaggaagtccgagatgatattaaaaccgcccgtaatgagttaagt
actggtaatcgtctgttctgggttaatcaggccgttttttatcaagctgaagatgaacaa
caggcacaagccatagaaaaaaacctgcataccatattcaacgatgcaaagatgccctta
attcattccagctatgatatccaccctttaaattcctggctcaatgccctgccatttaac
ttcgatccccactatgcccgtaagtacttatgctttgaccgcctgatgtatgccactgaa
cttgcagctttacttccagtctatggccggaaccaaggcgcaaggcatctaccctgtttt
ccttttttcaaccgcttaggcgagcctgttttctttgacttacttcaccatgattttatt
agccaaaattcgcattgcgctatcttcgctaactctggcggtggtaaatcggttttaaca
ggctggatgattcaatcactcctcgccatgaaaaacgcccgggtggtgctttttgaaatg
gggaactcgtttgaccggatgctcattcatgccaaagcccatggcaaaaaaaccaagcag
ttattattgagtaataagaaagaggaagccgttccattaaatccattttgtgaagcatat
aaagccattccagaaattacagataatttaagtgctgagcaagcctctttaatggctcaa
aaaatcctggatcttaaagatcctgcaaactcagaagatttagcttgtggtgatggttct
cgcgcatatctcgcagagcttgccttggctttgcgtaccatgattacggaagccaatgcc
ttggaagaagaacaatttaccttggctgatgaaactctgcttatcgaagtattaattgat
gccatcctaacctcatttaacaacggcattccacaaatgttgactgagcatattgtaagt
agctttaaacgacggttggataaagaaacggtgactcgcaagaaagaccgaattctggat
atgcacgaccgattaaacagttatgtcattaacagcgccaaatcacgattttttaatgtg
ccaacagaacctttaggtgattttgatatctttcatattgatatttcagcgattaaagat
gatacaggaaagctggctttggttatggtgtctttgttgccaagaattttggctatggca
gaagccactcaaaacgacaataggccgacctttctttttattgatgaatcccatctgcaa
tttcaaattccctctgtggtgactgtgtgtctattagttgccaaagtagccagaaaactc
gggctttggctggttgcaattacccaaaatgtcaccgacatgaattctgaaaaggctgca
aagattttatcgttaattgaaacctggattttattgggattggatgaaaaagaaatcact
gatgtgaaacgtttcaaatccttaacaccgcagcaggaaaccttaatcagagatattgat
tcacaaaaaggtttgtatgcagaagcggttttattagggtcacgctatcaaggattgttt
cgcgtcattccacctcgctacctgcttgcccttttaatgactgagaaatcagaaaaagca
caacgccacctcctggagaaagaacatgatgtccttgaagcagctgaaatcatggctaag
aaactcgagcaaccaaaaacgactactcataatagggcttatttttatgactaa

DBGET integrated database retrieval system