KEGG   Legionella pneumophila Paris (serogroup 1): lpp2392
Entry
lpp2392           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF87 AAA_10
Other DBs
NCBI-ProteinID: CAH13545
Pasteur: lpp2392
Position
2735075..2737849
AA seq 924 aa
MKLFSQISDWLLGQPNKPALTQQNIKKRFENHNPSFANQLSMVDFNDELNFFLLNDGVSI
GSGFELASIPAEAASTEHLHAVFSKIRDTFATVVPLHKEDPWVMQMYVNDEYSLKPVLSH
IQQSIAPDIAETSFTRDYLARLDDLFCKMTRPEGLFVDPKTDAPYRGRRRRIRVLFYRLY
QKTQTTREQALAEHQEIMAQIESKLLSPGLQLKQLTGKDYYQWLVRWFAANPEELLARFP
YPKDKKPAGYTLSQNILFYEPQSDEHGFIFDEMIHRILYIDGLKEAPEIGLLSREKPQAN
PKHRYALLDKLPEGATYTIQVVFENDEALDAHLMRLEKGIVGTSLKPSQVREDIKTARDE
LSIGNRLFWVNQSIFYRASTKDQAVRIEKELKELFIEAKMPLISSCFDIHPINSYLNALP
FNFNPQYARQYLRFDRLMYASELASLLPVYGRNQGARHLPCFTFFNRLGEPILFDVLHHD
FISQNSHMALFANSGGGKSVATGWMINSLMATKNARIILFEMGNSFDRILLHAKTHGKKT
KQLLLSNKKDEAVPLNPFCEAYKAIPEITDNLSTEQATLIVQKIRTIKENLEQPASSEEL
ACNDGSRSYLAELALALRTMITEANALEEEQFTLADETLLIEVLSDAILTSFNHDIPQML
TEHIVSSFKRRLDKETVPRKKDRILDMHDRLNSYVINSAKSRFFNVPTEPLGDFDIFHVD
ISAIKDDTGKLALVMVSLLPRILAMAEATQNDNRPTFLFIDESHLQFQIPSVVAVCLLVA
KVARKLGLWLVAITQNVTDMNSEKATKILSLIETWILLGLDEKEISDVKRFKSLTPQQEA
LIKDIDSQKGLYAEAVLLGSRYQGLFRIIPPRYLLALLMTEKSEKAQRHTLEKQHDVLKA
AELLAEQLENKKQSKNHDAYFYDD
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgaaattattcagccaaataagtgactggctgttaggacaacccaataaaccagcatta
acgcaacaaaacataaaaaaaagatttgagaatcacaacccttcctttgccaatcaattg
tctatggtggatttcaatgatgagctcaatttctttttactcaatgatggagtcagcatt
ggttcaggttttgaattagcctccattccagcggaggccgcctctactgaacatttacac
gctgtatttagcaaaattcgcgacacttttgccacggtcgtacctttgcacaaagaagat
ccctgggtgatgcaaatgtatgtcaatgacgagtacagtttgaagccggttctctctcat
attcaacaaagcattgcaccggatattgctgaaacgtcctttactcgtgactatttggca
aggttggatgatttgttttgcaagatgacaagacccgaaggcttgtttgttgatcccaaa
actgatgcaccttatcgcggcagacgaagacgaatcagagttttgttttatcgactctat
caaaaaacgcaaaccactagagagcaggcacttgctgagcatcaggaaatcatggcccaa
attgaaagcaaattactatcacctggtcttcaactaaaacaactaaccggtaaagattat
tatcagtggttggtgcgttggtttgcagctaaccccgaagaactattagctcgatttcct
taccctaaagacaaaaaaccagcgggctatactttaagccagaatattttgttttatgaa
ccgcaaagtgatgaacatgggtttatatttgatgagatgattcatcgtattctttatatc
gatggtcttaaagaagcacctgaaattggtcttttatctcgtgaaaaaccacaagccaat
cccaaacatcggtacgcacttttagataagttgcctgaaggtgctacctacactattcag
gttgtctttgaaaatgatgaagccttagacgcgcatctgatgcgtcttgaaaaaggcatc
gtaggaacaagccttaaaccgtcacaagtcagagaggatatcaaaactgcacgagatgaa
ttgtctataggaaaccgtctgttttgggttaatcaatctattttttatcgtgccagtacg
aaagaccaggcagtacgcattgaaaaagagctaaaagaattatttattgaagccaaaatg
cctttgatttcttcttgtttcgacattcatcccattaacagttatctcaatgccttacct
tttaatttcaatccacaatatgctcgccaatacttgcgctttgaccgattgatgtatgca
tccgaattagcctctttactgcctgtatatggacgtaatcaaggggcaagacaccttccc
tgtttcaccttttttaaccgtttgggagaaccaatactcttcgatgtgttgcatcatgat
tttatcagccaaaactcccacatggccttgtttgctaattccggtggcggcaaatcagtg
gctacaggctggatgattaattcgctgatggccactaaaaatgcccgcatcattctattt
gaaatgggaaattcttttgatcgtatacttctacatgccaaaacacacggcaaaaaaacc
aagcagttattactgagtaataaaaaagatgaagccgttccattaaatccattttgtgaa
gcttataaagccattcctgaaatcacggacaatctgagtacagaacaagcaaccttaatt
gtgcaaaaaattagaacaatcaaagaaaatctcgaacagcctgccagctcagaagagttg
gcctgtaatgatggatctcgctcgtatctagcagagctggccttagcgttgcgtaccatg
attactgaagccaatgcactggaagaagagcaatttactctggccgatgaaacactgtta
atcgaagtcttaagtgatgccatcttaacgtcatttaatcatgatatcccgcaaatgcta
actgagcatattgtaagtagctttaaacggcgactggataaagaaacagttcctcgcaaa
aaagaccgcattttggatatgcacgaccgattaaacagttatgtcattaacagcgccaaa
tcacgcttttttaatgtgccaactgaacctttaggagattttgatatcttccatgttgat
atctccgcgattaaagatgataccgggaagctcgctttagtgatggtgtctttattacca
agaatattggctatggcagaagccactcaaaacgacaacagaccaacctttctttttatt
gatgaatctcatttgcaatttcaaattccttcagtagtggccgtgtgtttactggttgcc
aaagtagccagaaagttaggtctttggcttgttgctattacccaaaacgtcaccgatatg
aattcggaaaaagccaccaagattttatcgctaattgaaacctggattttattaggcctt
gatgaaaaggaaattagcgatgtcaaacgctttaaatcattaactccacaacaagaagcc
ttaattaaagatattgattctcaaaaaggcttatatgcagaagcggttttattaggctca
cgttatcaaggattatttcgtatcattccacctcgctacttgcttgctcttttaatgact
gaaaaatcagaaaaagcacagcgccatactctggagaaacaacatgatgtccttaaagcc
gctgaattacttgcagaacaactcgagaataaaaaacaaagcaaaaatcatgatgcttat
ttctatgatgattag

DBGET integrated database retrieval system