KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074204
Entry
103074204         CDS       T03090                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lve01002]
    103074204 (ADAMTS13)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     103074204 (ADAMTS13)
Peptidases and inhibitors [BR:lve01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   103074204 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin_3 TSP1_CCN Reprolysin_4 TSP1_spondin Reprolysin ADAM_spacer1 Reprolysin_5 Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 103074204
NCBI-ProteinID: XP_007453197
UniProt: A0A340WZY2
Position
Un
AA seq 1522 aa
MPWLWQYLGQRHRRRTGGCTLSQAPAQPKAGPWREEPAGCPAPRPLPWEEAPTSKHSLII
QPSGSVAFHAGQTAVTAALSLPGRMSELCLQGRCVRAILISVPLVLLGCWGLPDFRQQFL
QALEPEEETAYFGPDAASKAPRFDVAPLTCVCEPEHEAEDGPGTALLGLLATSFTSERVV
NASLRLPGAPYPCLAGGLALLPRGAASRLTFCLGCVEGDILVGADMFYIQPLRRWHRELV
PPWGGAQPHLIHRPTPRAPTVPGRWLSALPPAPPGRPPAPRLRRGAARSLLHLELLVAVG
PDMHQAHQEDTERYVLTNLNMGSELLRDPSLGAQFRVHLVKMVILTQPEDAPNITANITA
SLRSVCEWSRTVNPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGVCSPSWSCL
IIEDTGFDLGITIAHEIGHSFGLEHDGAPGAGRARCVWDPPGPQSQPAGRPPEAHPGLYY
GADEQCRVAFGPTAVACTFRREHLDMCQALSCHTDPLDQSSCSRLLIPVLDGTECGVGKW
CSKGHCRSLAELAPVGAVHGHWSSWGPASPCSRSCGGGVVTRRRQCNNPRPAFGGHACVG
ADLQAKMCNSQACEKTQLEFMSEQCAQTNGEPLRLSPGSTSFYRWGTAEQYSRGDALCRY
LCRAIGESFIARRGHSFLDGTRCVPGSPQEDGTLSLCVSGSCKTFGCDGRMASGQVRDVC
QVCGGDNSTCRPQNGSFTAGRAREYVTFLTVTPNLTSIYIINHRPLFTHLAVRIRGRYIV
AGNASISPSTTYPSLLEDSHIQYKVTLTGDRLPRLEEIRIQGPTQDRMEIQVYRRYGEEY
GSLARPDITFTYFQPERRPAWAWAPVRGACSVSCGAGLRWVTHSCRDQAANEWVEAARCA
GSQQPAAWSESCASMPCPPQQEMPDACSSACGTDPAVQNTTCVQGADGMGAPATAGPCST
DEKPPALEPCIEVACPPGWSQPDAQSPGEKAASPAGSARPEAHATHVWTPLAGPCSVSCG
QGLMELRFVCMDSALRTPVREELCDLASKPGSQQEVCQVAPCPAWWRYQLAACSVTCGGG
VAQRILYCARAHGEDKAEEILPDTQCQGLPRPEQQEACSPEPCPPRWKVMSLGPCSASCG
LGTAMRLVACVQLDQGQDTEVDGAACVGLVRPQASIPCIIADCTYRWHVSAWMQCSVSCG
DGIQRRHDACLGPQARVPVPADFCQHLPKPVTVRGCWAGPCAGQGTPSSVPHEESTAPGQ
TTAAPASPEWPQRQAHLLSPAPRPQGLPPGPQKSPAESSACGRQHLEPTGTIDMRGPERA
DCAVAIGRPLGEVVTLRVLDSSLNCSAGEMLLLWGRLTWGKMCRKLPGMTFSSKANTLVV
RQRLVQLQGGVLLRYSSQPAPGAFHRGCDVQLFGPRGEIVSPSLSPDGRNMGGCRIFIDV
APQARIAIRALAMDMGTRTEETDSSYILIRDIHSLRTTTFRGQQTLYWESEGSQAEMEFS
QGFLVAHTSLRGQYWTLQAGAY
NT seq 4569 nt   +upstreamnt  +downstreamnt
atgccttggctctggcaatacctgggtcagcgacacaggcgcaggaccggtggctgtact
ctgagccaagccccagcccagcccaaggccgggccatggcgggaggagcctgcaggctgc
ccagcccctcggcccctgccctgggaggaagcgcccacgagtaaacacagcctcatcatc
cagcccagcgggtctgtcgcattccacgccggccagactgcggtcaccgcagcgctctcc
cttcctgggaggatgagtgagctttgcctccaggggagatgtgtgcgggcaattctcatc
tctgtgcccctcgtcctcctgggctgctggggactccctgatttccggcagcagtttctt
caggctttggagccagaggaagagaccgcttactttggccctgacgctgcctccaaagca
ccccgattcgacgtggccccgctcacctgcgtctgtgagcccgagcatgaggccgaggac
ggccctgggacggctcttctgggcctcctcgccacctccttcaccagcgagcgtgtggtc
aatgcctccctccggctgccgggggccccctacccctgcctcgcgggaggcctcgccctg
ctgccccgaggcgcagcgtccaggctcaccttctgcttgggctgtgtggagggcgacatc
ctggtgggtgcagacatgttctatatccagccattgaggaggtggcaccgggagctggtg
cctccctggggtggtgcccagccccacctgatccacaggcccacccccagggcaccaacg
gttccaggacgctggctctcggccctgccccccgccccgccaggccgtcctcccgcccct
cgcctgcggagaggggctgccaggagcctcctgcacctggagctgctggtggctgtgggc
cccgacatgcaccaggctcaccaggaggacacggagcgctacgtgctcaccaacctcaac
atggggtcagagctgcttagggacccatccctgggagctcagttccgagtgcacctggtg
aagatggtcatcctgacgcagcctgaggatgctccgaatatcacagccaacatcaccgca
tcactgcggagcgtctgtgagtggagcaggacggtcaaccctgaggatgacacggatccc
ggccatgctgacctggtcctctatatcaccaggtttgacctggaattgcctgatgggaac
cggcaggttcggggggtcacccagctgggtggcgtctgctccccgtcctggagctgcctt
atcattgaggataccggcttcgatctggggatcaccatcgcccatgagattgggcacagc
ttcggcctggagcatgacggcgcgccgggcgcaggacgggcgcgctgcgtgtgggacccg
ccggggccgcagtcccagcccgcggggcgccctcccgaggcgcaccccggcctgtactac
ggcgccgacgagcagtgccgcgtcgcctttggcccgacggcggtcgcttgcaccttccgc
agggagcacctagacatgtgccaggctctctcctgccacacagaccccctggaccaaagc
agctgtagccgcctccttattcctgtcctggatgggacagagtgtggcgtggggaagtgg
tgctccaaggggcactgccgctccctggcggagctggcccccgtgggggcggtgcatggg
cactggtctagctggggtccggccagtccttgctcccgctcctgcggaggaggtgtggtc
accaggagacggcagtgcaacaaccccagacctgcctttggggggcatgcgtgcgtaggt
gctgacctccaggccaagatgtgcaacagccaggcctgcgagaagacccagctggagttc
atgtcggagcagtgcgcgcagaccaacggggagcccctgcgcctctccccgggcagcacc
tccttctaccgctggggcacggccgagcagtacagtcgaggggacgctctgtgtagatat
ctgtgccgggccattggcgagagcttcattgcgaggcgtgggcacagtttcctggatggg
acacggtgtgtgccaggcagccctcaggaggatgggaccctgagcctgtgcgtgtcgggc
agctgcaagacgtttggctgtgacggcaggatggcctccgggcaggtgcgagatgtgtgc
caggtgtgtggcggggacaacagcacgtgccgtcctcagaacggctctttcacggccgga
agagccagagagtatgtcacattcctgaccgttacccccaacctgaccagcatatacatc
atcaaccacaggcctctcttcacgcacctggcagtgaggatccgtgggcgctacattgtg
gccggaaatgcaagcatctctcccagcaccacctacccctctctcctggaggacagccac
atccagtacaaagtgaccctgactggggaccggctgccccgcctggaagagatccgcatc
cagggccccacccaggaccgcatggagatccaggtttacaggcgctacggtgaggagtac
ggcagcctcgcccgcccagacatcaccttcacctacttccagcccgagcgtcggccggcc
tgggcgtgggctcccgtgcggggggcctgctcggtgagctgtggggcagggctgcgctgg
gtgacccacagctgtcgggaccaggcagcaaacgagtgggtggaggctgcccggtgtgca
gggagccagcagccggcggcgtggtccgagtcgtgtgcctccatgccctgtcctccccag
caggagatgccagatgcgtgctcgtcggcctgtggaacagatccggccgtgcagaacacg
acgtgtgtgcagggggcagatggcatgggggcgccagcaactgctgggccctgctccaca
gacgagaagccgcctgcccttgagccctgtatcgaggtggcatgtcctccgggctggagc
cagccagatgcccagtctccaggggagaaggctgcatccccagcgggcagtgccaggcca
gaggctcatgctacacacgtgtggactcccttggcagggccgtgctctgtctcctgtggt
caaggcctgatggagctgcgtttcgtgtgcatggactctgccctcaggacacccgtccgg
gaagagctgtgtgacctggcaagcaagcctgggagccagcaggaggtctgccaggttgcc
ccgtgcccggcttggtggcggtaccagctggcggcctgcagcgtgacctgtgggggagga
gttgcgcagaggatcctgtactgcgcccgggcccacggggaggacaaggccgaggagatc
ctgccggacacccagtgccaggggctgcctcgcccagagcagcaggaggcctgcagccca
gagccctgcccgcccaggtggaaggtcatgtcccttggcccatgttcagccagttgtggt
ctcggcactgccatgcgcttggtggcctgtgtgcagctggaccaaggccaggacacagag
gtggacggggcggcttgtgtaggtctggtgcggccgcaggccagcatcccctgcatcatc
gccgactgcacctaccggtggcacgtcagcgcctggatgcagtgctctgtctcgtgtggg
gatggcatccagcgccggcacgacgcctgccttggaccccaggcccgggtgcccgtgcca
gccgacttctgccagcatttgcccaagccggtgacggtgcggggctgctgggctgggccc
tgtgcagggcaggggacacccagctcggtgccccacgaggaatccactgctcctggccag
accacagctgcccctgcttccccggagtggccccagcgccaggcccacctcctctcccca
gctccccggccgcaaggactcccacccgggccccagaaaagcccagcagagtccagcgcc
tgtggccggcagcaccttgagccgacaggaaccattgacatgcgaggcccagagcgggcg
gactgtgcagtggccatcgggcggcccctgggtgaggtggtgaccctccgagtcctcgac
agttccctcaactgcagtgctggggagatgctgctgctttggggcaggctcacgtggggg
aagatgtgcaggaagctgcccggcatgactttcagctccaaagccaacacgctggtggtg
aggcagcgtcttgtgcagctgcaaggcggagtgctgctacggtattcgagccagcctgcc
ccgggagccttccaccgaggatgtgacgtgcagctcttcggaccccggggtgaaatcgtg
agtccatcattgagtccggatgggaggaacatggggggctgccgaatcttcatcgacgtg
gctccacaggcccggatcgccatccgtgccctggccatggacatgggcaccagaaccgag
gaaactgattccagctacatcttgatccgggatatccacagcctgaggacaacgacattt
cgtgggcaacagacgctctactgggagtcagagggcagccaggcagagatggagtttagc
cagggcttcctggtggcgcacaccagccttcggggccagtactggaccctccaggctgga
gcttattag

DBGET integrated database retrieval system