KEGG   Lipotes vexillifer (Yangtze River dolphin): 103076174
Entry
103076174         CDS       T03090                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lve03036]
    103076174 (ANKRD53)
Chromosome and associated proteins [BR:lve03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103076174 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 103076174
NCBI-ProteinID: XP_007453489
UniProt: A0A340X2E1
Position
Un
AA seq 550 aa
MSSLQDNWAAGLGWQAGRRRGRGGERGRHGDPRPRAPARPPERELEPRRAGGTPQAAAPL
RSVRQVRRLGGPAAWERVCERRGAGNRSGLPERPGVERRGSAGSVSLAEVWDQRAIGSYH
ELFAASLGNLEWLRLGLNRHRGEIPADNKGFTAIHFAAQSGKLACLQVLVEEYKFPADLP
TNNGQTPLHLVIQSDKKTTALPCIHYLIKQGAALNTQTCNGSTPLHLAAREGLLSCVKVL
VQKGANVHAQDAMGCKPIDYCKIWNHRICARFLKDAMWKQDKKDFACEMWKLKRLKNQLA
LMEEDYLTEYQKEHQILREADFKKWLHHKLLPQGQSLIRNTQGEPRPPPQATVLSKTPKH
GALWPPKSFYPFREARLRQTLQPSQPSVMPIPTCKQPMVRRPKVWNLSNNPARSPTAQIG
YPQGIRLGVHPDPKPEHDFRCFLEVRSDGHGGALLRTVAGNEVAPVPRLPLEVIIRELYP
SVQPCRMKVPQGFCSVTMREVPRKRRLGDATFWTDTLSMNLRETFDEGFLAAVRAHQGLP
TLPSPKPTPI
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgtcgagtctccaggacaactgggccgcggggctggggtggcaggctgggcggcgccgg
ggccgaggaggcgagcggggccgacacggcgaccctcgcccgagagcgcccgcccgaccc
ccggagcgcgagctggaacctcggcgggcgggcggcaccccgcaggcggcggcgcctctc
aggagtgtcaggcaggtacggcgactcggcggcccggcggcctgggagcgggtgtgcgag
cgtcggggcgcgggaaaccgctcgggcctcccggagcggccgggcgtggagcggcggggg
tcggccggctccgtgagtctcgcagaggtgtgggaccagagggcgatcgggagctaccac
gagctgttcgcggcctcgttgggcaacctggaatggttgcggttaggtctaaatcggcac
cggggggaaatcccggccgataacaagggtttcactgccatccactttgcagcccagagc
ggcaagcttgcatgcctgcaggtcttggtagaggagtacaagtttcccgcggacctgccc
accaacaatggccagacacctctacaccttgtcatccagagtgacaagaagaccacggcc
ctcccctgcattcactatctgattaagcaaggggcggccctcaacactcagacatgcaac
ggctccacacccctgcacctggcagcccgcgagggcctgctgagctgtgtgaaggtcctg
gtgcagaaaggtgccaatgttcatgcccaagatgccatgggctgcaagcccatcgactac
tgcaaaatatggaaccaccgcatctgtgcccggttcttgaaggatgccatgtggaaacag
gacaagaaggactttgcctgtgagatgtggaaactgaagaggctcaagaaccagctggcc
ctcatggaggaggactacttgactgagtatcaaaaagagcaccaaattctgagagaagct
gacttcaagaagtggctccatcacaagctgctgccccaaggccaatccctgatccgcaac
actcagggagagccccgtcctccaccccaggccactgtgctctccaagacccccaagcac
ggggcactgtggcctcccaagagcttctaccccttccgagaggcgcgcctgcgacagaca
ctgcagcccagtcagccctcggtgatgcctatacccacctgcaagcagcccatggtcagg
cggcccaaggtgtggaatctcagcaacaaccctgccaggtcccccaccgcccagataggc
tacccgcagggcatccgcctgggcgtgcatcccgaccccaagccggagcacgacttccgc
tgcttcctcgaggtgaggtccgacgggcacggcggtgcgctcctgcgcacggtggccggc
aacgaggtggcgcctgtgccccggctgcctttagaggtgataatccgcgagctgtacccg
tcggtgcagccgtgcaggatgaaggtgccccagggcttctgttctgtcaccatgagagag
gtgccccggaagcggcgcctgggtgatgccaccttctggaccgacactctgagcatgaac
ctgagagagacatttgacgaaggcttcctggcagctgtgcgagcccatcaagggctcccc
actctgccctcccccaaaccaacccccatttaa

DBGET integrated database retrieval system