KEGG   Methylomusa anaerophila: MAMMFC1_03752Help
Entry
MAMMFC1_03752     CDS       T05819                                 

Gene name
ribBA
Definition
(GenBank) riboflavin biosynthesis protein RibBA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
mana  Methylomusa anaerophila
Pathway
mana00740  Riboflavin metabolism
mana00790  Folate biosynthesis
mana01100  Metabolic pathways
mana01110  Biosynthesis of secondary metabolites
Module
mana_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:mana00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MAMMFC1_03752 (ribBA)
   00790 Folate biosynthesis
    MAMMFC1_03752 (ribBA)
Enzymes [BR:mana01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     MAMMFC1_03752 (ribBA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     MAMMFC1_03752 (ribBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: BBB93043
UniProt: A0A348APP5
Position
4065982..4067193
Genome map
AA seq 403 aa AA seqDB search
MKFNTIEEAVEDIKNGKIIVVVDDEDRENEGDLLMAAEKVTPEAINFMATYGRGLICMPV
IGARLDQLEVGAMVTDNTDALCTAFTVSIDAKNVTTGISAHERAATIKAVLDPDTKSEDL
RRPGHVFPLRSSEGGVLRRAGHTEAAVDLTKLAGLYPAGVICEIMNEDGTMARVPQLLEF
VHKHNLKIITIAELINYRKKHEKFVTRAAEAKMPTKYGTFKIIAYENSLDNQCHIALVKG
NIEGKQDVLVRVHSECLTGDALGSLRCDCGEQLGNALKRIEKEGTGVLLYMRQEGRGIGL
ANKIKAYALQDKGKDTVEANEILGFPADIRDYGIGAQILVDLGLTSIRLLTNNPRKLAGL
DGYGLKIKERVPLEIIANQYNRRYLSVKKVKLGHLLKQYEEAK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaataccattgaggaagctgttgaagacattaaaaatggtaaaataattgtg
gttgttgacgacgaggaccgggaaaacgaaggagacctcttaatggctgcagaaaaagta
actcctgaagccataaactttatggcgacttatggtcgtggtctaatctgtatgcccgtt
atcggcgccagactcgaccagttggaagttggggcaatggttacagataataccgatgca
ctctgtacggcttttaccgtatcaattgatgccaaaaatgtgaccaccggtatttccgcc
catgaacgggctgctactatcaaagccgttttagatcctgataccaaatctgaagatctg
cgccgccccggacatgtttttccgcttcgttccagcgaaggcggcgtattacgccgggcc
gggcacacagaagctgctgttgatttaactaaattagcaggcttatatcccgcgggcgtc
atttgtgaaattatgaatgaagacggtacaatggcccgtgttccgcagcttttggaattt
gtccacaaacataatcttaagattattacaatcgccgagcttattaactatcgcaaaaag
catgagaaattcgtcacccgggcagccgaagccaagatgcctacaaaatacggaacgttt
aaaataattgcttatgaaaattcactggacaatcaatgccatatagctcttgtcaaaggc
aatatcgaaggtaaacaagacgtcctggtgcgggtgcattccgaatgcttaaccggggac
gcactaggttcgctgcgctgtgactgcggcgagcagttgggcaatgctttaaaacgtatc
gaaaaagaaggtacaggagttctgttatacatgcgccaggaaggccggggaataggcctt
gccaacaagattaaagcctacgccttgcaggataagggtaaagacactgttgaagctaat
gaaattttaggctttcctgccgatataagggattacggcattggcgcacaaatactggtt
gatttaggtttgacaagcatccggctgcttacgaataatccacgcaaattagctggattg
gacggatacggtttgaaaattaaagagcgagttcccttggaaataatagctaatcaatat
aaccgccgttatttatcggtgaaaaaagtaaaactaggccatttacttaaacaatatgag
gaggcaaagtag

DBGET integrated database retrieval system