KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3929Help
Entry
Maqu_3929         CDS       T00454                                 

Definition
(GenBank) conserved hypothetical protein
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438 Endotoxin_mid
Motif
Other DBs
NCBI-ProteinID: ABM21209
UniProt: A1U890
Position
pMAQU02:complement(32291..33139)
Genome map
AA seq 282 aa AA seqDB search
MRKFIITSVAFLCVATSSWAEQIIHYDNLPVTIELHNGEERSIQFGSHVQVGITKGQQVK
KLFRAQSAQGAVHFLPYEAFDKQRVQIRRMDDGKVILLDLIATDKADGEKSLEDVRIVLA
SDNVVSSDDAAASMPEKVELITPIDLTRYAAQRLYGPTRLHHDQAGISETPLAVKGAVRI
FKGPARYKTLSKPVVAYQGGGYYLAALYIRNVSDETVQLDYLDLNLPFSHATLQHHSLEP
QGTPGDSTVLYLISERSLKETLYPWTYYQDLKRETQASIADS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaattcattatcacatcagtcgccttcctgtgtgtcgccacatcaagttgggcg
gaacagattattcattatgacaatctgccggtgaccattgagctgcataatggcgaggaa
cgatccattcagttcggttcccatgtccaggttgggattaccaaaggacagcaggttaag
aaactcttccgggcccagtccgcgcagggggccgttcatttcctcccttacgaggcattt
gataaacagcgtgttcaaatccgacgcatggacgacggaaaagtgatccttctcgatctc
atcgctaccgacaaagcagatggagaaaaatcacttgaggacgtccggatcgtgctggca
tcggacaatgtggtttcttcggacgacgctgccgcatcaatgcctgaaaaggttgagctg
attacgcccattgacctgactcgctacgcggcgcaaaggctctacggccccacccgactg
caccacgatcaagccgggatttcggaaacgccgcttgcggtcaaaggcgcggtacgaatt
ttcaaaggcccggcccgttacaaaaccctttcaaagcctgttgtggcctaccagggcggc
ggttattaccttgcggcgctgtacatccggaatgtttctgacgaaacggttcaactggat
tatctggacctcaacctgccgttttcacatgccacgttacagcaccacagtcttgagcca
cagggaacgcccggcgatagcacggtgttgtacctgatctctgagcggtccctcaaagag
acgctctatccctggacttactaccaggacctgaagcgtgaaacccaagcgtctatagcg
gacagctaa

DBGET integrated database retrieval system