KEGG   Metarhizium acridum: MAC_03493
Entry
MAC_03493         CDS       T03104                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
maw  Metarhizium acridum
Pathway
maw00910  Nitrogen metabolism
maw01100  Metabolic pathways
Module
maw_M00531  Assimilatory nitrate reduction, nitrate => ammonia
maw_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MAC_03493
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     MAC_03493
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske Rieske_2 NIR_SIR_ferr Rubredoxin_C Amino_oxidase
Other DBs
NCBI-GeneID: 19247804
NCBI-ProteinID: XP_007809833
UniProt: E9E0U5
Position
Unknown
AA seq 1035 aa
MYMNPLQWYDEASVSLGYRINTKVTYINSASKTVTCENGDVVPYDILVLATGSHASLPRH
TPGCDAKGVFVYRTIDDLISLIDFAAERKGSTGCVVGGGLLGLEAAKAMMDLESFSSVKL
IERNGWVLSRQLDQEAGGMVVQQVHDLGLDVMLSKRVREIKVDGANHVVGVAFEDGEELD
CSAVCFAIGITPRDELARVSGLDCVPRCGGIAVGDDLRTSQPDIYAIGECASWQGQTFGL
IGPGVEMAEVVAFNLTQAKLHAPRVFKRPDLSTKLKLLGVNVASFGDFFADRDGPAHLPA
KHNKLVNGAAKQAQTVKTLTYKDPFQNIYKKYIFTSDGKYLLGGMMIGDTNDYIKVSPMV
KTMKELDVPPSQFILGAKKDGDGDGDDDLPDDTQICSCHNVTKADVVNCVKDGSCKDLAA
VKSCTKAGTGCGGCMPLVTTIFNKTMAAMGNEVKNHLCPHFSYSRAELYHIISVKQLKSL
SEVMREAGTDDTSSGCEMCKPAVASILASLWNQHVMAKTTHGLQDTNDRYLGNIQRNGTY
SVVPRVPGGEITPDKLLAIGEVAKQYNLYTKITGGQRIDMFGAKKQDLVDIWSKLVAAGM
ESGHAYAKSLRTVKSCVGTTWCRFGIGDSVGMAVRLEERYKSIRAPHKIKGGVSGCVREC
AEAQNKDFGLIATEKGFNIFVAGNGGAKPKHSELLAKDVPPADVVPILDRYLMFYIRTAD
KLQRTARWLESLPGGIKYLREVILDDKLGICASLEAQMKDLVASYFDEWAEAIRDPEMVA
QFKQFQNTPDTVDNMETEQDRGQSRPVYWPKKPAAQDFGSMGGQWSSTAWEPVIETVYFD
GADELPNGISATIKRGDTQLAVWRFRGRYYATQQMCPHKRAFVLSDGLVGHNPAESCSND
DGTQQSAPWISCPQHKRNFDMRDGSCSNDGSLSIATFSVEPREDGLLYLKLPPVEELDAA
LGTTKWRVRKGESGDSPFAELDRKIQLVGRRSRRVNGIKPTVNGTLDGSVNGPGSENVRP
AVMAGGGGCGSAPDW
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgtatatgaatcctctgcaatggtacgatgaagccagcgtctcgctcgggtaccgtatc
aacaccaaagtcacgtatataaattcggcctccaaaacagtcacgtgtgaaaatggtgac
gtcgtcccctacgatattctggttctggccacaggttcacacgcctcattgccacggcac
acgcccggctgcgacgccaagggcgtatttgtctatagaaccattgacgatttaataagt
ctcattgactttgctgccgagcgcaaagggagcacgggatgtgtcgtcggcggtgggctc
ttgggtcttgaagccgccaaggcaatgatggaccttgagagcttcagttccgtcaagctg
attgagcgcaacggatgggtgctcagccgccagcttgaccaggaggcagggggcatggtc
gtgcaacaagtccatgatcttggcctagacgtcatgctgagcaagcgtgtgagggagatc
aaggtcgatggcgcgaatcacgtcgtgggtgtggcttttgaagacggcgaggagctcgat
tgctcggccgtgtgtttcgccattggcatcactccgagggacgagctggccagggtttca
gggctcgattgtgtcccgcggtgcggaggcatcgccgtcggagatgacttgagaaccagc
cagcccgacatttacgccattggcgagtgcgcaagctggcaaggccagaccttcggtctc
atcggccccggcgtcgagatggccgaagtcgtggcctttaacctgacccaggccaagctc
cacgcgccgagggtattcaagcgccccgatctgagtaccaagttgaagcttctgggcgtc
aacgtcgccagttttggcgacttcttcgcagacagagacgggccagcacatcttcccgcc
aagcacaacaagttagtcaacggcgcggccaagcaagcgcagacggtcaagacgctcacc
tacaaggaccccttccagaacatctacaaaaagtacatcttcacgtccgacggcaaatac
ctcctcggcggcatgatgatcggcgacacaaacgactacatcaaggtttcccccatggtc
aagaccatgaaggagctagacgtcccgccgagccagttcatcctcggcgcaaagaaggac
ggcgacggcgacggcgacgacgacttgcccgacgacacgcaaatttgttcctgccacaac
gtcaccaaagccgacgtcgtgaactgcgtcaaggacggatcatgcaaggacctggccgcc
gtcaagtcatgcacaaaggcgggcacggggtgcggcgggtgcatgcctctcgtcacgaca
atcttcaacaagaccatggcggccatgggcaacgaggtcaagaaccacctctgtccgcac
ttcagctactcgcgcgccgagctgtaccacatcatcagcgtgaagcagctcaagtccctg
agcgaggtgatgcgcgaggcgggcaccgacgacaccagctccggctgcgagatgtgcaag
cccgccgtggcgagcatcttggcctccctctggaaccagcacgtcatggccaaaaccacc
cacggcctgcaggacacaaacgatcgctacctgggcaatatccagcgcaacggtacctac
tctgtggtaccgcgcgtgccgggcggcgaaatcaccccagacaagctgctcgccattggc
gaggtggccaagcaatataacctgtacaccaagattaccggcggccagagaatcgacatg
tttggtgcgaagaagcaggacctcgtggatatatggagcaaactcgttgcagcgggcatg
gagtctggccacgcgtacgccaaatcccttcgcaccgtcaagagttgtgtaggcacgacc
tggtgccgatttggcataggtgacagcgtaggcatggccgtcagactggaagagaggtat
aagagtatcagggcaccgcacaagatcaagggtggcgtgagcggttgtgtcagagaatgt
gcagaagcccagaacaaggacttcggtctcatcgctacagagaagggcttcaacattttc
gtcgccggcaacggcggtgccaaacccaagcactctgagctccttgccaaggacgtgcct
cccgcagacgtggtccccatcctcgaccgctacctgatgttctacatccgcacggcggac
aagctccaacgcacggcgagatggctggagagcctccccggcggcatcaagtacctccgg
gaggtgatcctcgacgacaagctcggcatctgcgcctcgctggaagcgcaaatgaaggac
ctagtggccagctactttgacgaatgggccgaggccatcagggaccccgagatggtggcc
cagttcaagcagttccagaacacgcccgacacggtcgacaacatggaaacagagcaagac
agaggccagtctcgccccgtctactggcccaagaaacctgcggcccaggacttcggcagc
atgggcggccagtggtccagcacggcgtgggagcccgtcatcgagaccgtctactttgac
ggcgcagacgagctccccaacggcatctcggccaccatcaagcgcggcgacacgcagctc
gccgtttggcggttcagaggcagatactacgccacgcagcaaatgtgtccgcacaagagg
gcctttgtcctctcggacggcctggtcgggcacaatcccgcagagtcgtgctccaacgac
gacggcacgcagcagtcggcgccctggatctcatgcccgcagcacaaacgcaactttgac
atgagggacggctcctgcagcaacgacggctccctgtcgattgctaccttctcggtggaa
ccgcgtgaggacggcctgctgtatctcaagctgccgcccgtggaggagctggatgccgcg
ctggggaccacgaaatggagagttcgcaagggagagagtggtgactcgccctttgcagag
cttgacaggaagatacagctcgtggggaggagatcgcggagagtcaacggaatcaagccg
actgttaacgggacgctcgacggctcggtcaacggaccaggctcggaaaatgtccgtcct
gcggtcatggctggtggaggaggttgtgggagtgcaccggattggtga

DBGET integrated database retrieval system