KEGG   Macaca mulatta (rhesus monkey): 698820
Entry
698820            CDS       T01028                                 
Symbol
ASCL1
Name
(RefSeq) achaete-scute homolog 1
  KO
K09067  achaete-scute complex protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    698820 (ASCL1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    698820 (ASCL1)
SSDB
Motif
Pfam: HLH DUF6491 TFIIA Cas9-BH
Other DBs
NCBI-GeneID: 698820
NCBI-ProteinID: XP_001094978
Ensembl: ENSMMUG00000005747
UniProt: F6TP46
Position
11:102706442..102709316
AA seq 238 aa
MESSAKMESGGAGQQPQPQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQ
QQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPA
AVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHD
AVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
NT seq 717 nt   +upstreamnt  +downstreamnt
atggaaagctctgccaagatggagagcggcggcgccggccagcagccccagccgcagccc
cagccgcagccccagcagcccttcctgccacccgcagcctgtttctttgccaccgcagca
gcagcggcggccgcggcagccgcagcggccgcgcagagcgcgcagcagcagcagcagcag
caacagcagcaggcgccgcagctgagaccggcggccgacggccagccctcagggggcggt
cacaagtcagcgcccaagcaagtcaagcgacagcgctcgtcttcgcccgaactgatgcgc
tgcaaacgccggctcaacttcagcggctttggctacagcctgccgcagcagcagccggcc
gccgtggcgcgccgcaacgagcgcgagcgcaaccgcgtcaagttggttaacctgggcttt
gccacccttcgggagcacgtccccaacggcgcggccaacaagaagatgagtaaggtggag
acactgcgctctgccgtcgagtacattcgcgcgctgcagcagctgctggatgagcatgac
gcggtgagcgccgccttccaggctggcgtcctgtcgcccaccatctcccccaactactcc
aacgacttgaactccatggccggctcgccggtctcatcctactcctcggacgagggctct
tacgacccgctcagccccgaggagcaggagctgctcgacttcaccaactggttctga

DBGET integrated database retrieval system