KEGG   Monodelphis domestica (gray short-tailed opossum): 100016048
Entry
100016048         CDS       T01031                                 
Symbol
KLF13
Name
(RefSeq) Kruppel like factor 13
  KO
K09208  krueppel-like factor 9/13/14/16
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100016048 (KLF13)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100016048 (KLF13)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 Zap1_zf1 B129_C2H2-zf zf-C2H2_8 zf-Di19 zf-met zf-C2H2_6 DUF5810
Other DBs
NCBI-GeneID: 100016048
NCBI-ProteinID: XP_001365529
Ensembl: ENSMODG00000011740
Position
1:142862703..142969251
AA seq 275 aa
MAAAAYVDHFAAECLVSMSNRAIVHSPKEDPDTSPEGTAALPFPNAEDRREGRETGKDNA
SLIVVARILADLNQHVPAPVPPTEKRENVSKKEKLPSRLPPSGEPAQEAASPDSRWSGEA
ATPTSPAGSEPSLKQRSRRGRSRADPESPQKKHRCHYAGCEKVYGKSSHLKAHLRTHTGE
RPFACSWQDCSKKFARSDELARHFRTHTGEKKFSCPICEKRFMRSDHLTKHARRHANFHP
SMLQRRSGGSSRTGSVSDYSRSDASSPTISPASSP
NT seq 828 nt   +upstreamnt  +downstreamnt
atggcagccgccgcctatgtggatcattttgcagccgagtgccttgtttccatgtccaat
cgcgcgattgtccatagccccaaagaggaccccgacacctctcccgaaggcacagcagcc
cttccttttccgaatgctgaagacagacgagaaggcagagagactggcaaggacaacgcc
tctttgatcgtggtggccaggattttagctgatctcaaccaacacgttccagctcctgtc
ccgccgacggagaagagagaaaatgtctccaaaaaggagaaattacctagccgcctccct
ccgtcgggggagccggctcaggaagccgcctccccggacagccgatggagcggagaagca
gccacacctactagtccagcagggagcgagcccagcctcaaacaaaggagcagacggggg
agaagccgagctgaccccgagtcacctcagaaaaagcacagatgccactacgcgggctgc
gaaaaagtttatggcaaatcctcccacctcaaagctcacctaaggactcatacaggcgag
agaccctttgcctgcagctggcaggactgcagtaagaaatttgcccgttccgatgagctg
gcccggcacttccgcacccacactggggagaagaaattcagctgccccatctgcgagaag
cgtttcatgcgcagtgatcacctgaccaaacacgcccgccgtcacgccaacttccacccc
agcatgctccagcggcgaagcggcggcagctcgaggacgggctcggtcagtgactacagc
cgctcagacgccagtagccccaccatcagccccgccagctcgccctga

DBGET integrated database retrieval system