KEGG   Monodelphis domestica (opossum): 100018539
Entry
100018539         CDS       T01031                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mdo01002]
    100018539 (ADAMTS13)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100018539 (ADAMTS13)
Peptidases and inhibitors [BR:mdo01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100018539 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 ADAM_spacer1 TSP1_CCN Pep_M12B_propep Reprolysin_2 CUB Peptidase_M10
Other DBs
NCBI-GeneID: 100018539
NCBI-ProteinID: XP_001371722
Ensembl: ENSMODG00000012967
Position
1
AA seq 1601 aa
MVSTWMIFASAFFLLGSFQLPDFQERFLMALDPENIFYYFGAVSTLEALEFDVLQLSCLC
EDHETSRLHCKTQRCSFQALGELYVFQFPVELSLLIPSFTSRWVINSSLWLLRQYPDSCF
TGGKILLPSRAAAKITYCAGQLHGEIRVKGKQLYIQPLKSEHWNLLPDCCRAQPHLIHKA
MRAAGAPQVHRLSARISKRALGSVKHLELLVVVGHDVYEHHKEDTERYTLTNLNIGAELL
RDVSLGAQFRVHLIKMIILTEPEAHLNITTNLTSSLLSVCEWSQRINPPDDTHPHHADLV
LYITRFDLELSDGNKQVRGVTQLGGACSSSWSCLITEDTGFDLGVTIAHEIGHSFGIDHD
GAETNSCSSNDHIMAPGGTPNSIGLTWSKCSREQFLRFVSTGKASCVNDLPHLEGTIPRA
EPGLYYGADEQCRVAFGSAAVACTFSRDDVDMCQVLSCHTDPQDQTSCSRILIPLLDGTE
CGVNKWCSKGHCRSLEELTPVSLVHGQWSSWGLPSTCSRTCGGGVITRRRQCNNPRPAFG
GHDCTGADLKAELCNTQACVKTQLEFMSEQCAATDQKPLYLTPGIPTFYSWKSAAQYSQG
NDLCKHLCWAAGKNFIVSRGESFLDGTRCVPSDHQAVGTSSLCVMGKCRVFGCDGRMDSG
LVKDVCQVCGGDNTTCSRVSGSYTGGRAQEYVTFLTILPNFTTVLITNQKPLFTHLAVKV
RGHYVVSGKRRISSNTTHPSVLEDKQIEYRVFLTEEKMPHLEEIRIRGPTQEDIEIQVYR
KYGNEYGNLTRPEITFSYFKPKQQQSWVWAGVRGPCSVSCGEGVRQVSYSCFDQEQNKWI
DDVYCGGTVQPLLWQELCVPGPCTPHWAAGDFGPCSTTCGGGVRERTVSCVKVEGNLTLT
LPESYCKASLQPTATETCNPQPCLTRWKVSEPGPCSSVCGLGLAQRNVTCMEEGDGLEGL
VDDSLCSMEEKPSHLLPCVVTVCPLGWNTQEPGSFPEEALDQLGASWKENLTVYVWSPLI
GECSVSCGTGLRELRYVCLDFASRKEVQEAKCNPVSQPANQMMICHAASCPPRWEIKALA
PCPVTCGGGKVPLSVHCVRQDKGLTISLPHSKCGGMPRPSSYQDCSPEPCPARWRHKLAS
CSVSCGGGVVQRILYCARAFGENEEEIVPDIQCQELPRPEEQEPCSLDPCPPRWKIASTS
SCSASCGLGTAMRSMICVQLDHGEEAEVEEEACATLERPPASIPCIIADCTYQWHFSDWT
ECSTSCGNGIQRRHDFCVQPHQSHTPVPAIFCQHIPKSVTVRGCSAGPCGRQVTPKMKTQ
EEATTTLSPTTAAPTLILESPQNRALAIPNNQFSSSIQAKEHLRQEENTGSCGKQYLEPS
GTINMTGMPLAKCVVAIGRPLGEVVAFRVLESSLNCSVGEMLLFWGRLTWRKTCKNLAGV
TFISKTNTLVMRQRAVLPGSRVVLQYWSQVATENYHKECDVQLFGPRGEIVSPPRDQNMR
NQGGCRVFINVAPGARIAIHALAIDLGTEANQTSDSYISIRDMHNMKMITFHGQQLFYWE
SEGSRAEIEFSESFQEDNINFRGQYWILRVKGKSSSRDDLK
NT seq 4806 nt   +upstreamnt  +downstreamnt
atggtcagcacatggatgatctttgcttctgctttcttcctactgggatctttccagctt
ccagatttccaggagagatttctgatggctttggatccagagaatattttctattatttt
ggtgctgtttccaccctagaagccctcgagtttgatgtgcttcagctcagctgcctttgt
gaagaccatgagacctccaggctgcattgtaagacccagcgctgctccttccaggccctg
ggagaactctatgttttccagtttcctgtagagctcagcctcctgatcccatcctttact
agcagatgggtgattaactcctctctctggctgctgagacaatatccagacagctgcttt
acaggaggcaagatcttactgccctctagggcagcggctaagatcacttactgtgctggg
cagttgcatggggagatcagagtgaagggcaaacaactttacattcaacctctgaagagt
gagcactggaacctgttgccagactgctgtcgtgcccagccccaccttattcataaggct
atgagggcagcaggggctccacaagttcaccgactttctgctcggatctccaaaagggcc
ctaggaagtgtcaaacacctggagctactggttgtggtgggccatgatgtctatgagcat
cacaaggaagacacagagcgatatacccttaccaacctcaatatcggagcagagctgctg
agagatgtttccctgggagcccagttccgagttcacctgataaaaatgatcatcctgact
gagccagaggctcatctgaatattactaccaatctcacctcctcactgctcagcgtttgt
gagtggagtcagagaatcaatcccccagatgacacccacccacaccatgctgacttggtc
ctctacatcacaaggtttgatctggagctgtctgatggcaacaagcaggtacggggagtc
acccagcttgggggtgcttgttcctcctcctggagctgcctcatcacagaagatacagga
ttcgacctaggggtcaccattgctcatgagattgggcacagctttggtattgatcatgat
ggggctgagacaaacagctgtagcagcaatgaccacatcatggcccctggtggcacccca
aacagtattggcctcacatggtccaagtgcagccgagagcagtttctgcgctttgttagc
acagggaaggcaagctgtgtgaatgatctgcctcacctggaaggaacaataccccgggct
gagcctggcctctactatggggcagatgagcagtgcagagttgcctttgggagtgctgct
gtggcctgcaccttctccagggatgatgttgatatgtgccaagttctctcctgccataca
gaccctcaggaccaaacaagctgtagtcgtatccttatcccacttctagatggaactgaa
tgtggagtcaataagtggtgctctaagggccactgccgttctctggaagagttgacccca
gtctccttggtgcatggacagtggtctagttggggccttcctagcacttgctctcgaacc
tgtggaggaggagtcatcactagaagacggcagtgcaacaaccccagacctgcttttggt
ggtcatgactgtacaggagctgatctcaaggctgaactgtgcaacactcaggcctgtgtg
aagacccagctagagttcatgtctgagcaatgcgctgcgactgatcagaaaccactgtac
ctcactccagggattcccactttctatagctggaagtcagctgcccagtatagccaagga
aatgatctgtgcaagcacttgtgctgggcagctggaaagaatttcatagtgagtcgtggg
gaaagtttcttggacggtactcgctgtgtgccctcagatcaccaggctgtggggaccagc
agcctctgtgtgatgggcaaatgcagggtttttggatgtgatggcaggatggactctgga
ctcgtgaaggatgtgtgtcaggtctgtgggggagacaacactacgtgcagcagagtgagc
ggctcttacactggagggagggctcaagagtatgtcacattcctgacgattcttcccaat
tttaccactgtgcttatcaccaatcagaaacctctcttcacacacctggctgtgaaggtg
agaggacactatgtagtgtctgggaagaggcgcatctcatccaacaccacccacccctca
gtcctggaagacaaacagattgagtacagagtgttcctcaccgaggaaaagatgccccat
ctagaggagatccgcatcagaggacccacccaagaggacattgaaatacaggtttatagg
aagtatgggaatgaatacggaaacctcaccagacctgagatcactttcagctactttaag
cctaagcagcagcagagctgggtgtgggcaggggtacgagggccctgctcagttagctgt
ggggaaggggtccgtcaagtgagttatagctgctttgaccaagaacagaacaaatggatt
gatgatgtctactgtggagggactgtgcagcccctgttgtggcaggagctctgtgtccct
gggccgtgcacaccacactgggcagcaggagattttggtccctgtagcacaacttgtgga
ggaggagtgagagaacggacagtgagctgtgtgaaggtagagggcaacctcaccctgaca
ctcccagaatcctactgcaaagcttctctccagcccactgcaacagagacctgcaatccc
cagccctgccttaccaggtggaaggtgtctgaacctggtccctgctcttcagtctgtggt
ctgggtctagcccagaggaatgtgacatgcatggaggaaggagatggtctggaaggcctg
gtggatgacagtttatgctctatggaagaaaaaccttctcacctcttaccgtgtgtcgtg
actgtctgccccctggggtggaatactcaagaacctgggtctttcccagaagaagctctg
gaccaattgggagcttcctggaaggagaatctaacagtgtatgtgtggagccctctgatt
ggggaatgctcagtctcctgtggtacaggcttaagggagctacgatatgtttgtttggac
tttgctagcaggaaagaagtccaggaagcaaagtgtaacccagtgagccagccagcaaat
cagatgatgatctgccatgctgcttcctgtccacccaggtgggagatcaaagctttggcc
ccttgtccagtgacctgtggaggagggaaagtgccactctctgtccattgtgtgaggcag
gacaaaggcctaaccatcagtctccctcattccaagtgtggggggatgcccaggcccagc
agctaccaggactgcagtccagagccctgtcctgccaggtggcggcacaagctggcatcc
tgtagtgtaagctgtggaggaggggtggttcaaaggatcctctactgtgccagggctttt
ggggagaatgaagaagagattgtgcctgacatccagtgccaggagctacctcgcccagag
gaacaggagccctgcagccttgacccctgtccacccaggtggaaaatagcgtcaaccagc
tcatgctcagctagctgtggtctgggcacagccatgcgctcaatgatctgtgtgcagcta
gatcatggagaggaggcagaggtggaagaggaagcctgtgccaccttggagaggccccca
gctagcatcccttgcattatagcagactgtacctaccaatggcattttagtgactggaca
gagtgttccacctcatgtgggaatggaatccagcgccgccatgatttctgtgtccagccc
caccagtcccatacaccagtacctgccatcttctgtcagcacattcccaagtctgtgact
gtgaggggctgctcagctggaccctgtgggaggcaggtgacccccaaaatgaagactcag
gaggaagccacaacaaccctaagcccaacaacagctgctcctactcttatacttgagagt
ccccagaacagagccctggctattcccaacaaccaattttcttcatctattcaagccaag
gaacacttgaggcaggaggagaacactggttcttgtggaaagcaatatcttgaaccttca
gggaccatcaacatgactggcatgccattggccaagtgtgtagtagctattggtcgacct
ctgggggaagtggtggccttccgagtcctggagagctccctcaactgcagtgttggggag
atgctgctgttttggggacggctcacctggaggaaaacctgcaagaatttagcaggtgtg
acgttcatctccaaaaccaacactctggtgatgagacagcgcgcggtgctcccagggagc
agggtggtgctacaatactggagtcaagtagctacagaaaattatcacaaagaatgtgat
gtacaactctttggtcctcgaggggaaatagtgagtcctccacgggaccagaatatgagg
aaccaaggaggatgccgagtcttcattaatgtggctccaggagcccggatagccatccat
gctctggccattgatcttgggacagaagctaatcagacttctgacagctacatctcgatc
cgtgacatgcacaacatgaagatgataacattccatggacaacagttattttactgggag
tctgagggtagccgggctgaaattgagttcagtgaaagcttccaagaggacaacattaat
tttcggggtcaatactggatccttagagtgaagggaaaatcttcatctagagatgaccta
aaatga

DBGET integrated database retrieval system