KEGG   Chelativorans sp. BNC1: Meso_3854Help
Entry
Meso_3854         CDS       T00374                                 

Definition
(GenBank) ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mes00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Meso_3854
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mes02044]
    Meso_3854
Enzymes [BR:mes01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Meso_3854
Secretion system [BR:mes02044]
 Type IV secretion system
  Trb secretion system protein
   Meso_3854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagE_TrbE_VirB AAA_10 AAA_22 ABC_tran AAA_29 TraG-D_C AAA_16 AAA_21 FtsK_SpoIIIE AAA_23
Motif
Other DBs
NCBI-ProteinID: ABG65221
UniProt: Q11BK4
Position
4155079..4157571
Genome map
AA seq 830 aa AA seqDB search
MLNLAEYRNRSTRLADYLPWAALVAPGVVLNKDGSFQRTARFRGPDLDSATPAELVGTTA
RLNNALRRLGSGWAVFVEAQRVQATHYPDSQFPDAASALIDVERREQFEAEGVHFESRYF
LTFLWMPPAEEASRAESWLYEGKARTGVDPWELLAGFVDRTDRILQLVEGFVPEVDWLDD
GETLTYLHSTVSTRRQRVRVPEAPMYLDAILVDEPLAGGLEPRLGEHHLRTLTVTGFPTA
TFPGILDELNRLAFEYRWSTRAILLDKTDATKLLTRIRRQWFAKRKSVAAIVKEVMTNEA
STLLDSDAANKAFDADMALQELGSDDVGEAYVTATVTVWDRDPAIAVEKLRLVEKIIQAR
DFTSIPETINAIEAWLGSLPGQPYANVRQPPVSTLNIAHMVPLSAVWAGPERNDHLGAPP
LLYGRTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYTNNQIFAFDFGG
SIRIAALAMGGDWHDLGGGLSDGADATVSLQPLARIHDVPERAWAADWIVSILGREGVQI
TPEVKEHLWSALTSLASAPVDERTITGLSVLLQSNELKRALRPYCVGGPWGRLLDAEREH
LGEGSVQAFETEGLVGTGAASAVLTYLFHRIEGRLDGRPTLLIIDEGWLALDDENFADQL
REWLKTLRKKNAAVIFATQSLSDIGDSAIAAAIVESCPTRLFLPNERAIEPQILAIYRKF
GLNDRQIEILARATPKRDYYCQSRRGNRLFELGLGDVALALCAASSKQHHARVDRVLATA
GRDRFLEAWLGDCDLGWAADLIPDLPNIAGSEMAPADVPPPNQRPEEIDQ
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaccttgccgaataccgcaatcggagcacgcgcctcgcggactatctgccttgg
gctgccctcgtagcgccgggcgtcgtgctcaacaaggacggcagcttccagcgcacggcg
cgcttccgcggacccgacctcgactcggctacgccggccgagctggtcggcacgacggcc
cggctcaacaatgcgctgcgccgactcggcagcgggtgggccgtcttcgtcgaggcccag
cgcgtccaggcaacgcactatcccgacagccagtttcccgacgcagcctccgcgctgatc
gacgtcgagcggcgcgagcagttcgaagccgaaggcgtccatttcgaaagccgctacttc
ctgacctttctttggatgccgcccgccgaggaggcaagccgcgctgaaagctggctctac
gagggcaaggcgcgcacgggcgtcgatccctgggaattgctcgccggcttcgtcgatcgg
accgatcgtatcctccagcttgtcgaaggtttcgtgccggaggtcgactggctcgatgac
ggcgagacgctgacctatctgcattcgaccgtctcgacccggcgtcagcgggtgcgcgtg
cccgaagcgccgatgtatctcgacgcgattctggtcgatgagccgctggccggcggcctc
gaaccacgtctgggcgaacatcatctgcgcacgctcaccgtcaccggattccccaccgcg
accttccccggcatcctcgacgagttgaatcggctggcgttcgagtatcgctggtccacg
cgggcaatcctgctggacaagacggacgcgaccaagctcctgacgcgcatccgtcgccag
tggttcgccaagcggaagtccgtcgcggccattgtcaaagaagtcatgaccaatgaggca
tcgacgctgctcgacagcgacgcggccaacaaagcgttcgacgcggacatggctttgcag
gagctgggcagcgacgacgtgggcgaagcctatgtcaccgccactgttacggtttgggat
cgcgatcccgcaatcgcagtcgaaaagctccggctggtcgagaagatcatccaggcgcga
gatttcacgtcgatccccgaaaccatcaacgcgatcgaagcgtggctcggctcgttgcct
gggcagccttacgccaatgtgcggcagccgccggtctcgacgctcaacatcgcccacatg
gtgccactctcggccgtgtgggcggggccggaacggaacgatcacctcggcgcgcccccg
ctgctttacggcaggaccgagggatcgactccgttccggttctcccttcacgtcggcgac
gtaggccacacactcgtcgtcggcccgaccggcgccggcaagtccgtgctgctggcgctg
atggcgctccagttccgccgctacacgaacaaccagatcttcgccttcgatttcggcggc
tccatccgcatcgcagcgctcgcgatgggcggcgattggcacgacctgggcggcgggctc
agcgacggcgcagacgcgaccgtctcgctacagcccctcgcgcgcatccatgatgttccc
gaacgtgcttgggcagcggactggatcgtgtcgatcctcggccgcgagggcgttcagatc
accccggaggtcaaggagcatctatggtcggcgctgacctcgctggcctccgcgccggtc
gacgagcgcacgatcaccggactttcggtgctgctgcaatcgaacgaattgaagcgtgcg
ctgcgaccctactgtgtcggcggtccctggggtcggttgctcgacgccgagcgcgagcat
ctcggcgagggctcggtgcaggctttcgagaccgagggtctggtcggcaccggcgctgca
tctgccgtgctgacctacctcttccatcgcatcgagggtcgcctggacggccggcccacg
ctcctcattatcgacgagggttggctggcgctcgacgatgagaacttcgccgaccagctc
cgcgagtggctgaagacgctcagaaaaaagaacgctgccgtgatattcgccacgcagtcg
ctttccgacattggcgactcggcgattgccgccgcgatcgtcgagagctgcccgacgcga
ttgttccttcccaacgaacgtgcaatcgagccgcaaatcctcgcgatctaccgcaagttc
gggctcaacgaccgccagatcgaaatcctcgcgcgggcgacgcccaaacgcgactactac
tgccagagccgccgcggcaatcgccttttcgagcttggcctgggcgacgttgcgctcgcg
ctctgcgccgcatcctccaagcagcatcacgcccgtgtcgaccgtgtgctggccaccgcc
ggccgtgaccgctttctcgaagcgtggctcggtgactgcgaccttggctgggcggccgac
ctcattcccgaccttcccaacattgccggcagcgagatggcgccggccgatgtgccgccc
cccaaccagcgtccagaggagatcgaccaatga

DBGET integrated database retrieval system