KEGG   Pyricularia oryzae: MGG_00634
Entry
MGG_00634         CDS       T01027                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
mgr  Pyricularia oryzae
Pathway
mgr00910  Nitrogen metabolism
mgr01100  Metabolic pathways
Module
mgr_M00531  Assimilatory nitrate reduction, nitrate => ammonia
mgr_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MGG_00634
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     MGG_00634
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C Pyr_redox_3
Other DBs
NCBI-GeneID: 2674909
NCBI-ProteinID: XP_003718382
UniProt: G4NB36
Position
5
AA seq 1153 aa
MAAGNRKKIVVVGLGMVGISFIEKMMKLDARRREYDIVVLGEEPHLAYNRVGLTSFFDHR
KVDNLYLNPLEWYTGYTDGSLSYHINTTVTAIHPDSKTVSCSNGDEVSYDILVLATGSDA
VLPKHTPGHDATGVFVYRTIKDLQDLIAFAETKKETTGIVVGGGLLGLEAAKAMMDLQCF
EKVSVVERNSWVLSRQLDADAGGMVVEQVRDLGVDVQLRRRVGKVEVDADNNVTGVLFED
GEAMACSTICFAIGVRPRDAIAREAGIRCADRGGGVVVGDDLQTSIPDVYAIGECASWQG
QSFGLIAPGVEMADVLSFNLTQAKEHQPRSFKRPDLSTKLKLLGVEVASFGDFFADRDGP
QFLPPKAARKAKSAEKVGANGNGEVKKLTNGLPPSPVKSLTYKDPFTNVYKKYIFTVDGK
YLLGGMMIGDTRDYVKLVPLVKNQKELETPPSELILGAKKEGGDDGDDLDDDTQICSCHN
VTKGDVVEKVKDGSCKSIGDVKSCTKAGTGCGGCVPLVTSIFNKTMKDMGNEVKNHLCPH
FPYSRAELFHIISAKQLREFDDVMREAGTDPESFGCEVCKPCVGSIFASLYNKHVMSAKD
HGLQDTNDRFLGNIQRNGTFSVVPRVSGGEITPEKLIAMGEVAKEYGLYTKITGGQRIDM
FGAKKQDLLDIWGKLVNAGMESGHAYAKSLRTVKSCVGTTWCRFGIGDSVGMAVRLEERY
KSIRAPHKIKGGVSGCVRECAEAQSKDFGLIATDKGFNIYVAGNGGAKPRHAELLAKDVP
PSEVVPILDRYLMFYIRTADKLQRTARWLENLPGGIEYLREVVLKDKLGINAALEAAMEE
LVDGFFDEWAEAIQDPAIAAKFRQFANTDDKLDNMEVEVERDQLRPVHWPKEAAKEDFKG
LRSRWTETAWQPVMEASYFAEADGLPNGISAAIRRGDTQLALWRIRGRYFLTQQMCPHKR
AFILSDGLIGEEMSCSKEKGDNGSGITNGAAANGSLGVTNGGTNGMGVADAKRTAASGDG
GGGGSCNKNGNAAPWVSCPHHKRNFDLSSGACKNDEELSIATFEVEERPDGHVYAKLPPV
EELDAALGTSKWKVKLGDAGEGEHPFAELDRKIAFKGLRAKKVGLRPTAATLPLKSKNLA
VAVGGGCGSAPDW
NT seq 3462 nt   +upstreamnt  +downstreamnt
atggccgccggcaaccgcaagaagatagtggtggttgggttggggatggtgggcatcagc
ttcatagaaaagatgatgaagctggatgcccgcaggcgagagtatgacattgtggtcctc
ggtgaggaaccacacctagcctacaaccgtgtgggcctgactagcttctttgaccaccgc
aaggtggataacctctaccttaatcctttagaatggtacactggctacacggacggttcg
ctgagctatcacatcaacactactgtcaccgcaatccaccccgatagcaagacagtgtcc
tgttcaaacggcgatgaagtctcctatgacatcctcgtcctcgccactggctccgatgct
gtcctccccaagcacacgccaggccatgacgccactggcgtgttcgtttaccgaaccatc
aaggatctccaggacttgatcgcattcgccgagacaaagaaggagactaccggtatcgtt
gtcggcggaggcctactggggcttgaggccgccaaggccatgatggacctgcagtgcttc
gaaaaggtgtccgtggtagagcgcaacagttgggtgctcagccgacagctggacgccgac
gcaggtggcatggtcgtggagcaggtccgcgatctcggcgtggacgtccagctgaggagg
cgggtgggcaaggtcgaggtggacgccgacaacaacgtcaccggcgtgctgtttgaggac
ggtgaggccatggcgtgctccacgatatgcttcgccattggcgtgcggccgcgcgatgcg
atagccagggaggcggggatacggtgtgcagaccgcggcggcggcgtggtcgtgggcgac
gacttgcagaccagcatcccggacgtctacgccattggcgagtgtgcaagctggcagggt
cagtcgttcgggctcatcgccccgggcgtcgagatggcggatgttctctcgttcaacctc
acccaggccaaggagcaccagcccaggtctttcaagcggccagacctcagcacaaaactg
aagcttctcggggtggaggttgcgagctttggtgatttctttgccgaccgtgacgggccg
cagttcctgccgccaaaggctgcaaggaaggcgaagagcgcggagaaggttggggcaaac
ggcaacggcgaggtcaagaagctcaccaatggattgccgccatcaccggtcaagtcgctg
acgtacaaggacccgtttacgaacgtctacaagaagtacatatttactgttgacggcaaa
tatctgctcggaggcatgatgattggagacacacgagactacgtcaagctggtcccgctg
gtgaagaaccaaaaggagctcgaaacacccccgagcgagctcatactcggcgcgaagaag
gagggcggcgacgatggcgatgacctggacgacgacacacagatttgttcatgccacaac
gtcaccaagggcgatgttgttgagaaggtcaaggatggtagctgcaagtcgatcggagac
gtcaagtcgtgcacaaaggcaggcactggatgcggtggttgtgtgccgctcgtcaccagc
atcttcaacaagacgatgaaggacatgggcaacgaggtcaagaaccacctctgtccacac
ttcccgtactcgagggcggaactgttccacatcatatcggccaagcaactgagggagttt
gacgatgtgatgcgcgaggcgggaacggacccggagagttttggttgcgaggtgtgcaag
ccctgcgtgggctcgatattcgccagtctttacaacaagcacgtcatgtcggccaaggac
cacggcctgcaggacaccaacgaccgcttcctgggcaacattcagcggaacggcaccttt
agtgtcgtgccgcgtgtctcgggaggtgagatcacacccgagaagctcatcgccatggga
gaggtcgccaaggagtacgggctgtacaccaagatcactggcggtcagcgcatcgacatg
tttggtgccaagaagcaggatctgctcgatatttgggggaagctggtcaatgccggcatg
gaaagcggtcacgcctacgccaaatcgttgcgaaccgtcaagtcctgtgtgggaaccact
tggtgccgtttcggtatcggcgacagtgtcggtatggctgtgcgcctcgaggagcggtac
aagagcatccgggctccgcacaagatcaagggtggtgttagtggttgcgtgagagagtgt
gccgaggcgcaaagcaaagattttgggctcattgctaccgacaagggcttcaacatctac
gtcgctggaaacggcggcgccaagccaaggcacgcagagctgctggccaaggatgtgccg
ccatcagaagttgttccgatcttggatcgctacctgatgttctacattcgcacggcagac
aaactacaacggacggcaagatggctcgagaacctccccggaggcatcgagtacctccgg
gaggtggttctcaaagataaactcggcatcaacgctgcgctcgaggcagcgatggaggag
ctggtggacggcttctttgacgaatgggccgaggccatccaagaccccgcgatcgcggcc
aagttccgccagttcgcaaacacggacgacaaactcgacaacatggaagtggaggtggag
cgcgaccagctcaggccggtgcactggcccaaggaggcggccaaggaggacttcaagggc
ctgaggagcaggtggacggagacggcgtggcagccggtcatggaggccagctactttgcc
gaggcggacgggctgcccaacggcatcagcgccgcgatcaggaggggagacacgcagctg
gcgctctggaggatcaggggcaggtactttttgacgcagcagatgtgcccgcacaagcgg
gcctttatcctgtcggacgggctgatcggggaggagatgagctgcagcaaggagaagggc
gacaacggcagcggcatcaccaacggcgcggcggcaaacggctcgctgggcgtgaccaac
ggcggcaccaacggcatgggcgtggcggacgcgaagcgcacggcggcgtcgggcgacggc
ggcggcggcggcagctgcaacaagaacggcaacgcggcgccgtgggtgtcgtgcccgcac
cacaagcgcaactttgacctctcgagcggcgcctgcaagaacgacgaggagctctccatc
gccacctttgaggtggaggagcggcccgacggccacgtctacgccaagctccctcccgtc
gaggagctcgacgccgcgctcggcacctcaaagtggaaggtcaagctgggcgacgccggc
gagggcgagcacccctttgccgagctcgacaggaagatcgccttcaagggcctcagggcg
aaaaaggtcggcctgcgccccacggcggcgacgctgcccctcaagagcaagaacctcgcc
gtcgcggtggggggtggatgcgggtccgcgccggattggtga

DBGET integrated database retrieval system