KEGG   Pyricularia oryzae: MGG_01067
Entry
MGG_01067         CDS       T01027                                 

Definition
(RefSeq) monothiol glutaredoxin-5
  KO
K06125  4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
mgr  Pyricularia oryzae
Pathway
mgr00130  Ubiquinone and other terpenoid-quinone biosynthesis
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01240  Biosynthesis of cofactors
Module
mgr_M00128  Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate + polyprenyl-PP => ubiquinol
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MGG_01067
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mgr01006]
    MGG_01067
Enzymes [BR:mgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     MGG_01067
Prenyltransferases [BR:mgr01006]
 Compound prenylation
  4HB prenyltransferase
   MGG_01067
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 2675235
NCBI-ProteinID: XP_003717872
UniProt: G4NCJ1
Position
5
AA seq 417 aa
MASNIVSRQLRVASSTLATINVTARIVPRRVSWQSVLSIRSTPTYGHQRLPYHATKQALA
QKQLPLFDNNIKPPGEQAFAPPHPPAVYTPPKSLSFLPKSWVPYAELMRIDKPIGTYYLF
FPCLFSTLMAAPLATPMATPASVLGTTALFFTGALIMRGAGCTINDLWDRNLDPHVERTR
LRPIARGAITPFKAVAFTGAQLLTGLAVLLQFPVSCLFYGVPSLVLVTLYPLAKRVTYYP
QAVLGLTFSWGAIMGFPALGVDLLANEWALASAALLYSSNIAWTVLYDMIYAHMDAKDDV
KAGIKSIALKHFHETKDVLSGLAAAHTILLTCAGMAADAGPAFFILGCGGGYLTLSTMIK
RVNLKSPKDCWHWFIRGCGWTGGAITLGLFVDYCLRYREDQKFREEQAAARERVMAA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcatcaaatattgtgtccagacagctccgggtggcttcctccaccttggcaaccatc
aacgtaactgcgcggatagtaccaaggcgggtatcatggcagtctgtactctcgatacgg
agtacaccgacctatggtcatcaaaggctaccgtatcatgccacaaaacaggctctcgcc
cagaagcagttgccgctgtttgacaacaacatcaagccgccaggagagcaggcatttgca
cctcctcacccacccgccgtctacacccctcccaagtccctctccttcctcccaaagtcc
tgggttccctatgccgagctgatgcgcatcgacaagccgatcggcacctactacctcttc
ttcccctgtctcttctccaccctcatggccgcgcccctcgccacgcccatggcgaccccg
gcatccgttctgggcaccacggccctcttcttcactggagccctcatcatgcgcggtgcc
ggctgcaccatcaatgacctctgggaccgcaacctggacccgcatgtcgagcgcacacgc
ctgcggcccatcgcccgcggcgccatcaccccctttaaggcagtggccttcaccggcgcc
cagctgctgacgggtctggccgtgctgctgcagttccccgtgtcgtgcctattctacggc
gttcctagcctggtgctcgtcaccctgtaccctctcgccaagcgcgtcacctactacccg
caggccgtgctcggcctgaccttttcctggggcgccatcatgggcttcccggccctgggc
gtcgacctgctcgccaacgagtgggccctcgcgtcggccgcgctgctgtactcgtccaac
atcgcctggaccgtactgtacgacatgatttacgcccacatggacgccaaggacgacgtc
aaggccggcatcaagagcatcgcgctcaagcacttccacgagaccaaggacgtcctctcc
gggctggccgctgcccacaccatcctgctgacgtgcgccggcatggccgccgatgcaggc
cctgcatttttcatcctcggctgcggaggcggctacctcacattgagcaccatgatcaag
agggtgaatctgaaaagccccaaggattgctggcattggttcattagaggttgcggctgg
accggtggtgcgatcacgctcggcctctttgtcgattactgcttgaggtatcgagaggac
cagaaattcagggaagagcaagctgcggcgagggaaagggtcatggctgcataa

DBGET integrated database retrieval system