KEGG   Pyricularia oryzae: MGG_06878
Entry
MGG_06878         CDS       T01027                                 

Definition
(RefSeq) ATP-dependent permease MDL2
  KO
K05657  ATP-binding cassette, subfamily B (MDR/TAP), member 10
Organism
mgr  Pyricularia oryzae
Pathway
mgr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MGG_06878
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mgr02000]
    MGG_06878
Transporters [BR:mgr02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    MGG_06878
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 AAA AAA_5 AAA_29 AAA_30
Other DBs
NCBI-GeneID: 2685051
NCBI-ProteinID: XP_003709605
UniProt: G4MMX1
Position
1
AA seq 824 aa
MVSGAVRRTVLLPHLGAAGSAQLLLSARPHLIPLHEPLLPSAAIWTWSKIPVQAARSFAA
ATSTSFTCANNTAPAASRLSTLPAKAPTSFLGLGNRFSSPSGVLRRFSTTQTPWKQSVKE
TSLQDDSREDGKALENAEAKKDGDVASPNANLNDDGLESLGFKKSEKALKASQINMSARL
SKESKAQPSRAGMGEIWRLLKIARPELKWLAVAFVFLLISSSVTMSIPFSVGRILDLATK
GDVESTRIFGLTLTQFFMAFGAFLTLGAVANFGRIILLRIVGERVVARLRSQLYRRTYTQ
DAEFFDANRVGDLISRLSSDSVIVGKSITQNVSDGMRSIVSGCAGGVAMLWLSPKLTSIL
LLMFPPIAIGAFIYGRMIRNISRQIQRNLGTLTKIAEERLGNIKTSQAFAGEVQEVHRYN
TQIRKIFSLGKRESFVAATFYGSTGWAGNMTILALLVVGGGLVRSGSMSLGDLTSFMMYT
AFAGSSLFGVSGFYSELMKGVGAASRLFELQDRTPTIPQTVGLKVKSAQGPIKFSNVCFA
YPTRPAVSIFNGLDFEIPSGSNVCVVGPSGGGKSTVAGLLLRFYNPTSGTITINGVDISK
MNVKSLRRRIGMVAQEPVLFSGTVAENIAYGRPEASRAEIVAAAQKANCGFISDFPEGLE
TQVGARGAQLSGGQKQRIAIARALLKDPDILILDEATSALDAESETLVNSALAQLLKGRN
TTISIAHRLSTIKRSDKIIVLSSEGKVAEIGSYTELSANPDSAFSKLMEWQMSGGDIPTQ
QRPPPIITEAEAISEELEGDEAAAAEEEDVEGEHKDAKKTSEKQ
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggtttcgggagcggtgcggcgcaccgtgctgctcccgcacctcggagctgccggttca
gcacaactactcctctccgcgcgtcctcacttaatacccctccatgagccactgctacca
agtgcagccatttggacatggtcaaagattccggttcaggctgctcgaagtttcgctgca
gctacatcgacctcttttacgtgcgcgaacaacactgccccagcggcatcgcgtctcagc
acgctaccggcgaaggcgcccacgtcatttttaggcctggggaaccggttcagctcgcca
tcgggcgtcctgcgacgattctcgacgactcaaacgccatggaagcagtctgttaaggag
acgagcctgcaagatgattcgcgggaagatggcaaggcgctggagaacgcggaagctaag
aaggatggagatgtggcatcacccaacgcgaacctcaacgatgacgggctcgagtctcta
ggtttcaaaaagagcgagaaggcgctcaaggcttcccagatcaacatgagcgcgcgacta
tccaaggaaagcaaggcacagccctccagggccggcatgggtgagatatggagattgctc
aagattgcgcgaccagagctcaaatggctcgcagttgcatttgttttccttctcatctca
tccagcgtgaccatgtcgattcctttctcggtcggacggatccttgacctggcaaccaag
ggcgatgttgaaagcacccgcattttcggcctcaccttgacgcagttcttcatggccttc
ggtgccttcctgaccctgggtgctgtggccaactttggccgcatcatcctgctacggatc
gtcggcgagcgtgtcgttgcccgcctgcggtcacagctttaccgccgcacgtatactcag
gatgccgagttctttgatgccaaccgtgttggcgatctcatctcgcgtctcagctcggac
agtgtcatcgtcggaaaaagcatcacgcagaacgtgtcggacggcatgcgctcaatagtc
agcggttgtgctggtggcgttgcaatgctctggcttagccccaagctgacgtcgatcctg
ctgctcatgttcccgccaattgctatcggggccttcatatacggtcgcatgatccgcaac
ataagtcggcagatccagcgaaacttgggaaccctgaccaagatcgccgaggagcgtttg
ggaaacatcaagacaagccaggcttttgccggtgaggttcaagaggttcacagatacaac
acccagatcaggaaaattttctcccttggcaagagggagtcttttgtcgctgcaaccttc
tatggatctacgggttgggcgggcaacatgaccatccttgccttgctggttgttggagga
ggtttggttcggtcgggatctatgtctcttggtgacctcacttcttttatgatgtacacg
gcctttgcgggatccagtctcttcggagtctccgggttttactcagaactcatgaagggt
gtcggtgccgcaagccgtctatttgaacttcaggatcgcacgcctactattcctcagacg
gttggactgaaggtcaagtcggcacagggacccatcaaattctccaacgtgtgctttgcc
tacccaacccgcccagccgtttcaatcttcaatggcttggacttcgaaataccgtccgga
agtaatgtctgcgtggtcgggccttcaggtggtggcaagtcgaccgttgcaggtctactg
ctacgattctacaaccctacgtctggtaccatcaccatcaacggcgttgacatctccaag
atgaacgtcaagtctctcagacggcgcatcggcatggtggcccaggagccagtactgttc
tccggcaccgtcgcggagaacattgcctatggccggccagaagcctccagggccgaaatc
gtagccgcggctcagaaggccaactgcggatttatcagcgatttccccgaaggcctcgag
acgcaagtcggtgcccgcggcgcgcagttatctggtggccagaagcagcgcatcgccatc
gcgcgcgctctgctcaaggacccggatattctaatccttgacgaggcaacatcggcgctc
gacgccgagtcggagactttggttaactctgcgctcgcacagctgctgaagggacgcaac
accaccataagcatcgcccaccgtctgtcgaccatcaagaggagcgacaagatcattgtc
ctctccagcgagggtaaggtcgccgagattggaagctacacggagctgagcgccaacccc
gacagtgcctttagcaagctcatggagtggcagatgagtggcggtgacattccgacccag
cagaggcccccgcccatcatcaccgaggcggaggcgatctcggaggagcttgagggcgac
gaggcggcggcggccgaggaggaggatgttgagggcgagcacaaggatgcgaagaagaca
tcagagaagcagtaa

DBGET integrated database retrieval system