KEGG   Pyricularia oryzae: MGG_07084
Entry
MGG_07084         CDS       T01027                                 

Definition
(RefSeq) 3' exoribonuclease
  KO
K12587  exosome complex component MTR3
Organism
mgr  Pyricularia oryzae
Pathway
mgr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MGG_07084
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mgr03019]
    MGG_07084
Messenger RNA biogenesis [BR:mgr03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     MGG_07084
SSDB
Motif
Pfam: RNase_PH
Other DBs
NCBI-GeneID: 2682969
NCBI-ProteinID: XP_003715270
UniProt: G4MSP2
Position
2
AA seq 302 aa
MTDRRRINGPVGTTLPPVFFDEPIPDKPGPRTRSRPPNAIRKIFLKTGITPSASGSAYLE
IENPVVSGKEGETSTSGLKLSCTVHGPRALPRSTPFSPHIILSTHIKYAPFATKQRRGYI
RDSTERDLSVHLETALRGVIIADRWPKSGVDVIVSVIEGDQDRRLPLQDSGSGEEAWSTM
SVLSGCITVASAALADAGIDCVDMVAGGVAALVRDDSDGAKSVEGGSIVVDPVPAEHDKI
VAACCVAYLPNRDEVTNLWFKGDAAASDSALYLNIVNNSVRASKIANRVLVDSLKETLQQ
QD
NT seq 909 nt   +upstreamnt  +downstreamnt
atgactgatcgcaggcggatcaatggtcccgtagggacaacgcttcctccggtatttttc
gatgaacctataccagacaagccgggcccacggacgaggtcaaggccaccaaatgccatt
cggaaaatttttctcaaaactggcataacaccttctgctagcggctctgcttatctagag
attgagaatccggtggtgtctgggaaggaaggggagacctcaacatcaggtctcaagctt
tcgtgcacagtacatgggcccagggctttgccaagatcaacacctttctcgccgcacatc
atactctctactcacatcaagtacgcgccttttgcgaccaaacaacggcgcggctacatc
cgcgactcgacagagcgggatctatccgtgcacctggagactgccctgcgcggtgtcatc
attgccgaccgatggcccaagagcggtgttgatgtgatcgtctccgtcattgaaggagat
caagaccgccggctgcctctccaggatagtgggagcggcgaggaagcctggagtaccatg
agcgtcttgagcggctgcatcacggtggcctctgctgctcttgccgatgctgggatcgac
tgtgttgatatggtggccggcggtgttgccgcacttgtacgcgatgatagcgacggggct
aagtctgtggagggtggctcaatagtggttgaccctgttcctgcagagcatgacaagata
gttgccgcctgctgcgttgcatatctacccaacagagatgaggtcacaaacttgtggttc
aagggggatgcggcagcctcggattcggcgctgtatttgaatatagtcaacaacagtgta
agggcatccaaaattgccaaccgagtcctggtggacagtctgaaggagacactacagcaa
caagattaa

DBGET integrated database retrieval system