KEGG   Mesorhizobium japonicum MAFF 303099: mlr6395
Entry
mlr6395           CDS       T00043                                 
Name
(GenBank) conjugal transfer protein; TraG
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    mlr6395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr6395
Enzymes [BR:mlo01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     mlr6395
Secretion system [BR:mlo02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   mlr6395
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: BAB52699
UniProt: Q989J7
Position
5217849..5220056
AA seq 735 aa
MSPLRHSSPRECANIDTPRKRATARQTAPHRTKSYIGRIPVPAVPGDARSISPEQRSKPV
TPTKLLIGQIAIVFAIVLLGVWAATQWCAHMLAFQEQLGAPWFVAAGWPIYEPWKLLEWW
FQFDAYAPEVFDKAGMLAGTSGFMGCAAAIAGSLWRARQRGLVTTYGSSRWAATREIEKA
GLFQPAGVFLGKLKDRYLRHDGPEHVMAFAPTRSGKGVGLVVPTLLSWSGSAVIHDIKGE
NWQLSSGWRSRFSHCLLFNPTDPRSARYNPLLEVRKGSDEIRDVQNIADILVDPEGALER
RNHWEKTSHSLLVGAILHVLYAEEEKTLARVATFLSDPQRSFAATLRRMMTTNHLGAANK
PQVHPVVASAAREVLNKSENERSGVLSTAMSFLGLYRDPTVAAVTSDCDWRIADLMDAEW
PMSLYLVVPPSDISRTKPLVRLILNQIGRRLTERLEGDPKKSRKHQLLMMLDEFPALGRL
DFFETALAFMAGYGIRAYLIAQSLNQISKAYGDNNAILDNCHLRIAFSSNDERTAKRISD
ALGTATELRSMRNYAGHRLAPWLSHVMVSRQETARPLLTPGEVMQLPPADELVLVSGLPP
IRAKKLRYYEDHNFTERVLPSPVLRDGPYADCPMSRPDDWTGQVRGVDRRLASDDESAGA
ALADEGGVQQQRHPGLPEEHTAVTQEPDQDDLSRPADDDSEAMADKRVMDRISTVAGAYG
INEGRGDDKDIVPGF
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgagtcccctccgacatagcagtccacgggaatgcgcgaatattgatacacctcgaaag
agagcaacggcgcgccaaacagcccctcatcgcaccaagtcgtacatagggcgcattcct
gttccggccgtcccgggcgatgctcgatccatctctccagaacagcggagcaagccagtg
acgcccacgaagcttctgattgggcagatcgccattgtgttcgccatcgttctcctcggc
gtgtgggctgccacgcaatggtgcgctcatatgctagcctttcaggaacaactcggcgcg
ccatggtttgtcgcggctggctggccgatctacgagccgtggaaactgttggaatggtgg
ttccaattcgatgcctatgcgcccgaggtattcgacaaggcgggcatgcttgcgggcacc
agtggattcatgggctgtgccgctgcgatcgctggttccctctggcgcgcgcgccagcgc
ggcttggtcaccacctatggctcctctcgatgggcggcgacgcgggagatcgagaaagca
gggctgtttcagccggcaggcgtcttcctcggcaaactgaaggaccggtatctgcgtcat
gacgggcctgagcacgtcatggcctttgcgccgacacgttccggcaagggcgtcggactg
gttgtcccaacccttctctcctggtccggctcggccgtcattcacgacatcaaaggcgag
aactggcagctgagctccggctggcggtcgaggttctcgcattgccttttattcaatccg
actgatccgcgatcggcccgctacaacccgctgctggaggtacgcaaaggttcggacgag
attcgcgatgtccaaaacatcgccgacattctagtcgatccggaaggcgcgctggagcgg
cggaatcattgggagaagaccagtcattcactcctggtcggcgctatcttacacgtcctc
tacgccgaagaggaaaagactcttgcccgcgtcgccacctttctgtcggacccgcaacgc
tcgtttgccgcgactttgcggcgaatgatgacgaccaaccatctcggcgcggccaataag
cctcaggtccatcccgtcgtggcctcggcggcacgagaggtgttgaacaaatcggagaac
gaacgttcaggcgtcctctcgaccgccatgtcttttctcggcctctaccgtgatccgacc
gtggcggcggtaacatcggactgcgactggcgcattgccgatctgatggatgcggagtgg
ccgatgtcgctctatctggtcgtgccgccatcggacatctcgcgcaccaagcccttggtg
cgactgatcctgaaccagatcggcaggcggctgacggagcgcctcgagggtgacccaaag
aagagccgcaagcatcaactgctcatgatgctggatgagtttccggcgctcggtcgcctc
gacttctttgagaccgcgctcgcgtttatggccggttacggaattcgtgcctacttgatc
gcgcaatcgttgaaccagatctccaaagcgtatggcgacaacaacgccattctggacaac
tgccatttgcgaattgccttttcctccaatgatgagcgcacggccaagcgaatctcggac
gcgcttggcacggccacggaactcagatccatgcgcaactatgcgggccaccggctggca
ccttggctctcgcatgtcatggtgagccgccaggaaaccgcccgcccgctgctgacaccg
ggcgaggtgatgcaattgccgcccgcggacgaactggtgctggtttcgggattgcccccc
atccgggccaaaaagctgcgatactatgaggatcacaatttcaccgagcgggtgctacct
tcgccggtgttgcgcgacggaccctacgcggactgcccgatgtcgcggccggacgattgg
actgggcaagtacgcggcgtcgaccgtcgtcttgcgtccgacgatgaaagcgctggcgcc
gcgcttgcggacgagggaggtgttcagcagcagcgccatcctggcctacccgaagaacat
accgccgtcacccaggaaccggaccaggacgatctgtccagacccgcagacgatgatagc
gaggcgatggcggacaagcgcgtcatggaccggatctccaccgtcgcaggtgcctatggc
atcaacgagggaaggggcgatgataaggatatcgtccccggcttctga

DBGET integrated database retrieval system