KEGG   Mus musculus (mouse): 100019Help
Entry
100019            CDS       T01002                                 

Gene name
Mdn1, 4833432B22Rik, A130070M06, AA958993, D4Abb1e, Gm135
Definition
(RefSeq) midasin AAA ATPase 1
  KO
K14572  midasin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    100019 (Mdn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    100019 (Mdn1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    100019 (Mdn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_5 AAA_lid_7 AAA_lid_5 AAA_16 AAA AAA_7 AAA_3 Dynein_heavy TsaE AAA_14 Sigma54_activat ABC_tran AAA_22 AAA_18 Sigma54_activ_2 NACHT AAA_6 DUF815 AAA_33 T2SSE Mg_chelatase PduV-EutP AAA_25 AAA_29 AAA_8 DnaB_C cobW
Motif
Other DBs
NCBI-GeneID: 100019
NCBI-ProteinID: NP_001074861
MGI: 1926159
Ensembl: ENSMUSG00000058006
Vega: OTTMUSG00000004945
UniProt: J3QMC5
Position
4 A5; 4 14.3 cM
AA seq 5582 aa AA seqDB search
MEHLSVELVSGPLRLIAAKNEKSSGELNRFLAKSVWTPQDRQCILDSLAQLLLDKDYTLL
LGRQLRPILLDLLERNAKAIKTGGQVNHDLHERLSVSMSKLIGSHPDVLPFALRYFKDTY
PVFQRLFLESSDANPVRYGRRRMKLRDLMEAANIFLQHRQTVFRELWDWSVCVPLLRSHD
ALVRWHTANCLALVTCMNEEHKLSFLRKIFSSDELVHFRLRLLEEAQLQDLEKALVLANP
EVSLWHKGEEPQYIQGHLVSADLSSSVAAVCGVVLPKLSSSPGEQASDRSSSLEQELALK
SFVLVESVCKNLQLLAVSVASQNAVLLEGPIGSGKTSLVEHLAAVTGRTKPPQLLKVQLG
DQTDSKMLLGMYRCTDVPGEFVWQPGTLTQAATKGYWILLEDIDYAPLDVVSVLIPLLEH
GELLIPGHGDCLKVAPTFQLFATRRLLSCGGSWYRPMNSHATMLDKYWTKIHLHNLNKKD
LNEVLQSKYPSLLAATDHLLDIYIELTGEKHCCPSVAYDKAPQEVSEAERENRRVVLEGR
ELSLRDLLNWCNRVAHGFDPTSSTALLHIFQEAMDCFTAMLSEQTKKLRMAEVIGSRLNI
SKKKAEFYCKLYKPEIVINELDVQVGRVRLLRKQSEVVRIQKEKCTFAATRPSSVLLEQL
AVCVSQGEPVLLVGETGTGKTSAVQYLAYATGQHLRVVNMNQQSDTADLLGGFKPVDHKL
IWLPLRETFEELFVQTFSKKQNFTFLGHIQTCYRQKRWHDLLKLMLHVQKSASTKGGEQS
QPGLLKEKWEAFGLRLNHAQQQMKMTENALLFAFVEGTLAQAIKKGEWILLDEINLAAPE
TLECLSGLLEGSSGSLVLLDRGDTEPLVRHPDFRLFACMNPATDVGKRNLPPGIRNRFTE
LYVEELESKEDLQILIVDYLKGLNVSKNTVQGIVNFYTALRKESGTKLVDGTGHRPHYSL
RTLCRALRFAASNPCGSIQRSLYEGFCLGFLTQLDRASHPVVQKLICQHIISGNVKSLLK
QPIPEPKGGRLIQVEGYWISVGDKEPKIDETYVLTPSVKLNLRDIARVVSAGTYPVLIQG
ETSVGKTSLIRWLAAASGNHCVRINNHEHTDIQEYIGCYTSDTSGKLVFNEGVLIDAMRK
GYWIVLDELNLAPTDVLEALNRLLDDNRELLITETQEVVRAHPRFMLFATQNPPGLYGGR
KVLSRAFRNRFVELHFDELPSSELETILHKRCSLPPSYCSKLVKVMLDLQSYRRRSSVFA
GKQGFIALRDLFRWAERYRLAEQTQEDYDWLQHLANDGFMLLAGRVRKQEEADVIQEVLE
KHFKKKLCPQSLFSKENVLKLLGKSSTQTTVLESKFSHVVWTESMRRLAVLVGRALEFGE
PVLLVGDTGCGKTTVCQMFSALANQKLYSVNCHLNMETSDFLGGLRPVRQKPNDKDELDT
RLFEWHDGPLVLAMKEDSFFLLDEISLADDSVLERLNSVLEVEKCLVLAEKGSPESKDNE
VELLTAGKHFRILATMNPGGDFGKKELSPALRNRFTEIWCPQSTKREDLIQIINHNLRPG
LSLAGVGHKGAGVAEVMLAFITWLTRQEFGRKCVVSIRDILSWVNFMNSMAEDAAVKRPE
AISTVTSFVHAACLVYIDGIGSGVTSSGFGTALLAREECLKFLIKKLSKVVRLTQRQKDE
LKIYDRLRHKEFTSIDDFWGVHPFFIPRGPVLDGHNTGDYALTAGTTAMNAQRLLRAAKL
NKPILLEGSPGVGKTSLVAALAKASGNTLVRINLSEQTDITDLFGADLPVEGGRGGEFAW
CDGPLLAALKAGHWVVLDELNLASQSILEGLNACFDHRGEIYVPELGMSFQVQHEKTRIF
GCQNPFRQGGGRKGLPKSFLNRFTQVFVDPLTVVDMEFIASTLFPTIDKDIVKKMVAFNN
HIDHEVTVEKKWGQKGGPWEFNLRDLFRWCQLILVDQSPGCYDPGQHVFLVYGERMRTRE
DKEKVVAVFKDVFASNSMPYIGTRQFHITPYDIQIGYSVLSRSSYVPHPSRRPLSLLHQS
FQSLEPIMKCVQMNWMVILVGPASVGKTSLVQLLAHLTGHTLKIMAMNSAMDTTELLGGF
EQVDIIRPWRLLLEKVERTVRVLLRDSLLINSVDTEVVLQAWSHFLLTYKPKCLGEDGKG
VTIEIVNKLEAVLLLMQRLNNKINSYSKADFAKLVEDFRSFGVKLLQSASGRSHGSFEWV
DSMLVQALKSGDWLLMDNVNFCNPSVLDRLNALLEPGGVLTINERGMVDGSTCTVTPNPN
FRLFLSMDPIHGEISRAMRNRGLEIYISGEEDGSIQDNLDLKVLLHSLGLVGDSVCNILL
ALHTEIQSLVRGSPASSVSTLSHTAILIVQYLQRGLSLHKAFFEACWEVYVCSQHSAANQ
KLVQDLLESHTASLQARETWGHSILATGLWPDSVPSALFATEDSRLSVVRSEGQILAYCL
NRMSLKTSSWTRSQPLTLQDLENIMQTCSPDDLTFNAVEVDTCWVDEPEVLATAVKLLIE
RATNQDWMLRVKWLCHLAKNIPQGLESVRVHLEASATALRKFYSTSLSAGVSNVLKILQT
NITDDFVIPLDPRWNMQALDIIRNSLDFDPQSDQAKQLFALLESVANKTFIYLDREKRIF
TEANLVSVGSKKLRSSVLRMSFEFHKDPENYHSPPHEIVANLAAFFELIDGLILLWVQSP
QGVVPDAHINKILGSVQWRDRFWTVADTVTVDASGLALLALHWHWVSKHLIYQIPQLLVN
QENKYYKELQTVSEHIHSCLGSPADSFAGVKKLQAFLGRPFPFKDKLVVDCFLQLQALNR
ALAIGEQLPVFGECGWQEDINRLQVVASEWNLKKSLLQAWGLILRANILEDVNLDELKNL
VSTQCSELKSRGLSRGFLEKAHDASSPSQPDLSSLVHLTRRVQLWPAAEYLAMLWQYRVT
ADFIAQACLRRSSKHDQMDEEISHHIAFCLKHTPIAPQKLWNLWSLLHIEMLSAQEVSCL
WSELFTSTFGSSWSSPVTTAPECWLAWSPLPNIQQQEVPRSRWDSTLKGPGSLCRAVFSK
CCFGVLTNSSRASYWDVSGLPLLSSSHVTLGEWVERAQQLQDISSLLWTNMAVPSVAEFR
RTDSRLQGLVLCRYLLGLTELLPAHQRQEYMQNCEHLLLGNTQAFHHVDQTMGNIGGQEA
LPKELLCLLLTSLHYFIGEGEGKQNLPEAARRGRLWVSLGLLQIQTWLPRARFDPAVKKA
YKLRYAQDELRQLQCELKTRNLLSHLQTGRDLEDDIITSHSHPHIKLLPQRISQLESLVH
SLSKKQAFRPHLPSYETLVQEIHHYVTSIAKVTAVQDLLMRLLQALHTDGPKSAQVLQNL
LKEEASWQQSHHQFRKRLVEEYALYPDTVAPLLASILQLQHGMRLVASEVHASLHSGVLC
AENLGALAMAVLAFPSVGPSFPTYHAHADALCSVNAAEALRSLGKLMVKRAARKEEAKSQ
QAYPTREQLLMNALLYLRSHVLCKGELDQRALLLFRHLCQEIINEWDEQERIAQEKAEQE
SSLYRYRSRSGRTALSEEEEEELELRKLFPLHEKDFADILMEPTLEEKKKVSDGREEEAA
PDPTLLCQSSMQAVMLIHQQLCLSFARSLWYQQAVPPHEAKHYLSLFLSCYQTGASLVTH
FYPLMGVELNDQLLGSQLLACTLSSNTLCGEATSDLMMRPDGPYDFYQHPNVAEARQCQP
VLQGFSEAVSQLLQDWPEHPVLQQLLVVMDRIRGFPLSSPISKFLNGLEILLAKAQDWEE
NASRVLSLRKHLDLVSQMIIRWRKLELNCWSMSLDNTMIRHTEKSTKHWFSIYQMLEKHM
QERTEEQEDDKQMTLMLLVSTLQAFIEGSSLGEFHVRLQMLLVFHCHVLLMPQVEGKDSL
CSVLWNLYHFYKQFLDPVKAKIMELRSPIEKELKEFVKISKWNDVSFWSIKQSVEKTHRT
LFKFMKKFEAVLSEPCQSCLVESDKEEQPDCLPKPTEEATMETSPIQGLNNALRETLLAQ
PVEWKPSGTEQCQDASPLSVEGELLRRLPRLSKRMRKMCLVFMKESPLPHLVESLDQFTG
GVISSVSELQSLKVDPSAEKEKQHSEAKHILLQKHRALSDLFKHLANIGLSYRKGLAWAR
SKSPQELLHLHPLDLRSALSIVSSTREADSRLLTEISSLWDGCQKYFYRSLARHTRLTAA
LATPVKEVSMGTIERCKGFSAHLMKLLIRQRHSLTTLTEQWIILRNLLSCVQEIHSRLTG
PPVYPVAFPPQDSVQQWTERLQHLAMQSQILLEQFSWLFQCCPSAEPTVGHRDAQVQEHP
SASHLENIDFKETIAGVMPDLLSSDLSYPSPVPTSQLPSACRMRRQDQLWQQSTAGLTEM
LKTIKTMKAGVDKIRQQSCETLFHTWEDFEVCSSGLNCLSQVSAHLQGLASLFILPGIEV
EQTDSRMALVESLDYLRGEVSKAIDDFTAWKARLFVAHKQEGNQMVEESFVEDFSEQVET
AIRAILCTIQNLAERNNKKAEDSAVDKRLQEEDEASFKSLQPGHLTKLLEDDFWASVSTL
HVQKIISSVSELLERLKSCSEDGNTTKHKVFSQSCGLLVRLIPILCGFSDLVLFFLTVSL
ATHRSTAKLLSVLAQTFTELSQKGFCLPKELMEDSAGEGATQFHDYEGGGIGDGEGMKDV
SDRIENEEQVEDTFQKGQEKDEEDLDSKPDTKGEDNAIEMSEDFDGKMHDGELEQEEDDE
KSDSEDGDLDKQMGNLNGEEADKLDERLWGDDEEEDEDGDGRAEETGPGVDEEDSELVAK
DDSLDAGNLNKNKKHQDEKEDSEPEDVEQGQEKINEQIDEREYDENEVDPYHGNQEKLPE
PEALDLPDDLKLDSEDKSGGEDTDNEEAEEENPLEIKEKTVDMEETDHEIEEPGAGQDEG
ESPHEPEEGPSEDKENMDMDTGADDQDRDTSSHAEEHSLEEEAEEEEEKGEKEEDKATTD
GGGESGVNPVDQGLQPQEEEEGEQSDAEEQVPEATERKEHATCGQTGVDNVQSAQAVELA
GAAPEKEQGKEEHGSGAADANQAEGHESNLIARLSSQQHTNKNTQSFKRRPGQADNERSV
GDYNERVRKRLRTVGTDRETEQEPTQAQVEDADAFEHVKQGSDAYDAQTYDVASSEQQQT
AKASGQDQEEEEIEDILMDTEEELMRAEDTEQLKPEAVQSETAATSGSSEMEVDMQTLKT
KEDQDPRTTTPHQETENERPERSRDSTIHTLRQFLVDSVFQPILKDISELRQEMERQLET
WQAHDYGNAEEEKAAAEMWQNYLVLTASLSQQLCEQLRLLLEPTQAAKLRGDYRTGKRLN
MRKIIPYIASQFRKDRIWLRRTKPSKRQYQICLAIDDSSSMVDNHTKQLAFESLAVIGNA
LTLLEVGQIAVCSFGESVKLLHPFHEQFNDSSGTHILRLCTFQQRKTKIAQFLETVAKMF
AAAQKLSQNVSPETAQLLLIVSDGRGLFLEGKDRVLAAVQAAQNANIFVIFVVLDNPNSR
DSILDIKVPIFKGPGEMPEIRSYMEEFPFPFYIILRDVNALPETLSDALRQWFELVTASD
HS
NT seq 16749 nt NT seq  +upstreamnt  +downstreamnt
atggagcacctctctgtggagctggtatccgggccgctgcggctaatcgccgccaagaac
gagaagagcagcggcgagctgaacaggttcctggccaagtcggtgtggacacctcaagat
cgccaatgcatcctggattccttggcacagttgctcctagataaagactatacccttttg
cttggtcgccagttgcgccctatccttttggatttgctggaaagaaatgctaaagccatt
aaaactggaggccaagtcaaccacgatctgcatgaacgactcagtgtgtcaatgagcaaa
ctcattggtagccatcctgacgttcttccgtttgccctgcgctattttaaggacacctat
ccagtgtttcagagactcttccttgagagttctgatgcgaacccagtgcgctatggacgt
aggcggatgaagctccgggacctaatggaagcagccaatatatttctacagcacaggcag
actgtttttcgggaactctgggactggagtgtgtgtgttcctctcctcaggagccatgat
gctttggtgcgctggcatacagctaactgtctcgctttggtgacctgtatgaatgaggaa
cacaagttatccttcttaaggaagatcttcagtagtgatgagttggtgcatttcaggttg
aggttgttagaagaggctcagctacaggatctggagaaggccttggttttagccaaccca
gaagtctccctttggcataagggagaggaacctcagtatattcaggggcacctagtttca
gctgacctctcttccagtgtggcagctgtctgtggtgtggtgctccctaagctatcctcc
agtcctggagagcaggcaagtgacaggagttcttccctggaacaggagctggctcttaag
tcctttgtgttggttgagtctgtgtgtaaaaatcttcagctgctagctgtttcagtggct
tctcaaaatgctgtgttgttggaaggaccaataggaagtggcaaaacctccttagttgaa
catttagctgcagtgactggtagaacgaaacctcctcagcttctcaaagtccagcttgga
gatcagacagacagcaagatgctactaggcatgtatcgctgtacagatgtccctggagag
tttgtatggcagcctggcaccctgacacaggcagccacaaaaggttactggatccttctg
gaggatattgactatgctcctttggatgtggtttctgtgttgatccctctgctggaacat
ggagagcttctgattcctggccacggcgactgtttaaaagtagctccgacatttcagctg
ttcgcaaccaggaggctcttgagctgtggaggaagttggtaccgaccaatgaatagtcat
gctactatgctagacaaatactggaccaaaattcacctgcataatctgaataagaaagac
ctgaatgaggttcttcagagcaaatacccaagcctcttagctgcaactgatcacttgctt
gacatttatatcgagcttactggagaaaaacattgctgtccaagtgttgcctatgacaag
gcaccacaggaagtttcagaagctgagagagaaaacagaagagtggttcttgagggaaga
gaattatctttaagggatctgctgaactggtgtaatagagttgctcatggctttgaccct
acatcttcaacagcattgttgcatatttttcaggaggctatggactgtttcactgctatg
ctttctgagcagacaaaaaaactgagaatggcagaggttattgggagcagactgaacatt
tctaagaaaaaggctgaattttactgtaagctttataaaccagaaattgtcattaatgag
ctagacgtccaagtaggtcgagtgcggcttttacggaaacaaagtgaagttgttcgaatt
cagaaagagaagtgcacttttgctgctacccgcccgtcctctgttctccttgagcagctc
gcagtgtgtgtcagtcaaggggagcctgtgttgttagtgggagagacaggaactggtaaa
acctccgctgtccagtacttggcttatgctacaggccagcatttgagagttgtcaatatg
aatcaacaaagtgacactgcagacttgcttggagggttcaagccagtggaccataagctt
atttggttgcctctacgagagacatttgaggaactatttgtccagacattttccaaaaag
caaaactttacctttttgggacacattcagacctgctacaggcagaaacgatggcatgat
ctgctcaaactaatgctgcacgtacagaagtcggccagtaccaaaggaggggagcagagc
cagccagggctccttaaggagaaatgggaagcatttggccttagactcaaccatgcccag
caacaaatgaaaatgacggaaaatgcccttttgtttgcatttgtggagggtactttagct
caggctataaaaaaaggagaatggatcttactggatgagattaacctggctgctcctgaa
accctggaatgtctgagtggcttacttgaaggatcttctggctctctggttttgcttgat
cgaggagacacagagccactggttcggcaccctgattttcgtttatttgcatgtatgaat
ccagctactgatgtgggcaaaagaaatctcccaccaggaataagaaacaggttcacggaa
ctttatgtagaagaattagaaagtaaagaagacttacaaatacttattgtggattatctg
aaaggactgaacgtgagcaagaacactgtgcaaggcattgtaaacttctacactgctttg
aggaaagagtcaggaaccaaattggtcgatggaactggccacaggcctcactacagcctt
cggaccctctgcagagctttacggtttgcagcttccaacccatgtggcagcatccagcgc
tcactctatgagggcttttgtttggggttcctaacacagcttgaccgggcatcacaccca
gtggttcagaagctcatctgtcaacacattatttctggcaatgtcaaaagtctactgaaa
cagcctattccagaacctaaaggaggccgccttattcaggttgaaggctactggatttca
gttggagacaaggagcctaaaatagatgaaacatatgtcttgacgccttctgttaagctg
aacctgagggacattgcccgagtggtctctgcaggaacctatccagtgctgatccaggga
gaaacatcagttggtaaaacaagcctgataaggtggctggctgctgcttctggcaaccac
tgtgtgagaattaacaatcacgaacacacagatattcaggaatacattggctgttacacg
tctgacacctcagggaagcttgtctttaatgaaggtgttcttattgatgctatgagaaag
ggctactggattgtcttagatgaattaaatttggcacctactgatgtgttagaggccctc
aacagactgctggatgataaccgtgaactgctcataacagaaacacaggaagttgttagg
gcgcaccctcgcttcatgctttttgccacccaaaatcccccaggactttatggaggtaga
aaggtgctgtctagagctttcagaaaccgatttgtggaattacactttgatgagttgccc
agttctgagttggaaacaattttgcacaagcgatgtagtttacctccttcctattgcagt
aaattggttaaagtcatgttggaccttcagtcctaccggagacggtcctcggtgtttgct
ggaaagcaggggtttattgcccttagagatctgttccggtgggctgaaaggtacagattg
gctgagcagactcaggaggactatgattggctacaacacttagccaatgatggcttcatg
cttctggcaggcagagtcaggaagcaggaggaagctgatgtaattcaagaagtccttgaa
aaacatttcaagaaaaaattgtgtcctcagtctcttttttccaaagaaaatgttctaaag
ttactgggtaaatcgtctacccagacaactgtgttggagtctaagttcagccatgtagtg
tggactgaaagcatgcggagactggcagtgctggtgggcagggcgctggaattcggtgaa
cccgtactgctagttggagacactgggtgtggaaaaactactgtctgccaaatgttttca
gccttggcaaatcagaaactatactcagtcaactgccatttaaacatggagacatcagac
ttcctgggtggtttaagaccagtgagacaaaagccaaacgacaaggacgaactggacaca
agactcttcgagtggcatgatggaccactggttctggccatgaaggaggacagctttttc
ctcttagatgagatctccttggctgatgactctgtcctagaaagactgaacagtgtcctt
gaagtggaaaagtgtctggtattggctgagaagggcagcccagaaagcaaggacaatgaa
gtagagctcctgacggcagggaaacatttccgaatcttagcaaccatgaaccccgggggc
gactttggtaaaaaagagctatctcctgccttacgaaaccgatttacagaaatatggtgc
cctcaaagcacaaaacgtgaggacttaattcagataataaatcataatcttcgtccagga
ttgtctctagccggagtgggtcataaaggagctggcgtggctgaggtgatgctggctttc
attacctggctgacccgccaggagtttggacggaagtgtgttgtcagtatcagagatatt
ctgtcttgggttaacttcatgaactcaatggcagaggacgctgctgtgaaaaggccagag
gccatctctactgtgacgtcttttgtccatgccgcatgcctggtgtacatagatgggata
ggttcaggggtaacttcctctggatttggtacagccctcttggctcgagaagaatgtctg
aaatttctaataaagaaactttccaaggtagtgcgactaacgcaacggcagaaagatgag
ttgaagatttatgatagactcagacacaaagaattcactagcatagatgacttttgggga
gttcatccattctttataccaagaggacctgtcctggatggccacaatactggtgactat
gcactcactgcaggcaccacagctatgaatgcccagaggctcttaagagctgctaaactg
aacaaacccattctcctggagggttcacctggtgttggcaaaacaagtttggtggctgcc
ttagcaaaggcttcaggaaataccctggttcgaatcaatttgtcagagcagacggacatc
actgatctgtttggagccgatctacctgttgagggtggcagaggtggagagtttgcctgg
tgtgatggccccttgctggcggctttgaaagccggccactgggttgtgttggatgagctc
aacctggcgtctcagtccatccttgaaggactcaatgcttgttttgatcatcgaggagaa
atctatgtaccagagctaggcatgagctttcaagttcagcacgagaagacccggattttt
ggttgtcaaaatccctttagacaaggaggtgggaggaagggcttgcctaagtctttcctt
aacagattcactcaggtctttgtggatccccttacagtagttgacatggagttcattgcc
agtaccttgttcccaaccattgacaaagatattgttaagaaaatggtagctttcaataac
catattgatcatgaagtgactgttgagaagaaatggggacaaaaaggagggccctgggaa
ttcaacctccgagaccttttccgctggtgtcagttgatactggttgaccagtctcctggc
tgctatgatcctggtcagcatgtgtttctagtttatggtgaacgaatgagaaccagggag
gacaaagaaaaagttgtcgctgtatttaaggatgtgttcgcttccaattccatgccatat
ataggaactagacaatttcatatcactccctatgatattcagattggctactcagtcctt
tctcgcagcagctatgttcctcacccatcccgccggcccctgtcactcctgcaccaatca
ttccagtctctggaacccatcatgaagtgtgtgcagatgaactggatggtcatccttgtg
gggccagcctctgtgggcaagaccagcctggtccagcttctggcacaccttactggccac
accttaaagatcatggctatgaatagtgcaatggatactactgagcttctaggcggattt
gagcaggttgatattatccgaccttggaggctactacttgagaaggtagagcgtactgtc
agggtcctgctaagggatagtcttcttatcaattctgttgacacggaggtagtattgcaa
gcctggagccattttcttctgacatataaacctaaatgtcttggtgaagatggtaaaggt
gtcactatagagattgtcaacaaactggaagcagtattgctgcttatgcagcgactcaat
aataaaatcaactcatactccaaagcagattttgccaaacttgttgaagatttccggagt
ttcggggtaaagcttctgcagtcagccagtggccggagtcatggcagctttgagtgggtt
gacagcatgttagttcaggccctaaagtctggcgattggcttctgatggacaatgtcaat
ttctgcaatccctcagtgctggatcgtctgaatgccttattggaacctggaggtgtcctc
acaattaatgagagaggaatggtagatggatccacttgcacagtgacaccaaatcccaat
ttcaggctttttctctccatggatcccattcatggagaaatttcccgagctatgaggaac
cgtggacttgaaatctacatttcgggagaagaggatgggagtatccaagataacctggat
ttaaaagttctgctgcacagccttggattggtgggggacagtgtgtgtaacatcctcttg
gctctgcacacagagatccagagccttgtgagaggttctccagcatcatctgtctccact
ctcagccacacagccatactcattgttcagtacctgcagagaggtctgagcttacacaaa
gccttttttgaagcatgctgggaagtatatgtctgctctcagcattcagcagcaaaccag
aagcttgtgcaggatttgctggaaagtcatactgcatctctgcaagctagggaaacttgg
ggacactccattcttgccacagggctgtggccagattctgtgccttcagctctctttgca
acagaagactctcgactctcggttgtccggagtgaagggcagatcctagcatactgcctc
aacaggatgagcctgaagactagcagctggacaaggagtcagcctcttactttacaagac
ttagagaatattatgcagacttgtagccctgacgacctgacgttcaatgcggtggaagtg
gatacttgctgggtcgatgaaccagaggttttagccacggctgttaaattgctcatagaa
agagcaaccaatcaggattggatgctcagagttaagtggctttgtcatctagccaagaac
ataccgcaggggcttgagtcagtgcgggttcatctggaagccagcgccactgctcttagg
aagttttactcaacttctctctcagctggagtcagtaatgtcttgaaaatattacagaca
aatataacagatgactttgtgatccccttggaccctcggtggaatatgcaagctttggac
atcattagaaattcactagactttgatccacagtcagaccaggctaaacagctctttgct
ctcttagaatcagttgcaaacaagacatttatttatcttgaccgggaaaagaggattttc
actgaagcaaatttggtatctgttggtagtaaaaagttgagaagcagtgttttgaggatg
tcttttgaatttcacaaagatccagagaactatcatagcccgccccatgaaattgtggcc
aatcttgctgccttttttgaattgattgatggcctaatcctgctctgggtacagtctccc
caaggggtggttccagatgcccacatcaataagatcttaggttctgtgcagtggcgtgac
cggttttggactgtggctgatacagtgacagtagatgcttcaggtctggctttacttgcc
ctccactggcactgggtttcgaaacatttgatctatcagatcccccaactcctggtgaat
caggaaaacaaatactataaagagttgcagacagtttccgagcacatccacagttgtctg
ggcagccctgctgacagctttgctggtgtaaagaagctgcaggcattcctcggacgacca
ttcccttttaaggacaagctggtagtggactgttttctacagctacaggcccttaacaga
gcccttgctatcggagaacagctgcctgtctttggggaatgtgggtggcaagaagacatt
aatcgtctccaagtggttgcttctgaatggaatttgaagaaaagtctcctacaggcctgg
ggattgatcctcagagccaacattctggaagatgtcaatttagatgaattgaagaatctt
gtgagcactcagtgttcagaactgaaaagcagaggactttcacgtggctttctggagaaa
gcacacgacgcttcctccccatcccagccagacctcagctctttagtccacctcaccagg
cgagttcagctgtggcctgcggccgagtacctggctatgctgtggcagtacagagtgaca
gctgactttatagcgcaggcttgtctgagaaggtcaagcaagcatgaccagatggatgag
gagataagtcatcacatcgccttttgtcttaagcacacaccaattgcacctcagaagctt
tggaatctttggtctttactgcatattgagatgttgtctgctcaagaagtttcttgtttg
tggtcggagttatttacctctacatttgggtcttcctggagcagcccagtcaccacagct
ccagagtgttggctggcatggagccctctgcctaatatccagcagcaggaagtgcccagg
tcccgctgggactccacactgaagggccctggcagcctctgcagagctgtgttctccaag
tgctgctttggtgtgctaacaaacagcagtagagcaagctactgggatgtgagtggcctg
cccctcctgtcttcctcacatgtcactctgggagagtgggttgagagagcccagcagctc
caggacatcagttcattgctgtggaccaacatggctgtgccctcagtagctgaattcaga
cgcacagattctcggctccaggggctggtcctgtgcaggtacctgctaggtctcacagag
cttcttcccgcacaccagcggcaggagtacatgcagaactgtgagcatctgctgcttggg
aacacgcaggccttccaccatgtggaccagactatggggaatataggtggtcaagaggcg
cttcccaaagaactgctctgccttctgctcacctctttgcactactttattggtgaaggg
gagggtaagcagaaccttcctgaagcagcccgtcgtgggaggctctgggtgagccttggc
ttgctccagattcagacttggcttcctcgggcccgctttgaccctgcggtgaagaaggca
tataaactcagatatgcccaagacgagttacgccagctgcagtgtgagctgaagacccgg
aacctgctgtcccacctacaaaccggaagagacctggaagatgacataattaccagccac
tctcatccacacatcaagttacttccccaaaggatcagtcagctggagagtttagttcac
agcctgtcaaaaaaacaggctttcagaccccacctacccagttatgagaccttggtgcaa
gagatccaccactatgtcaccagcatcgccaaggtcactgctgttcaggacctgctcatg
cggcttcttcaggccctccacacagatggaccaaagtctgctcaagtgctccagaacctt
ctgaaggaggaagcctcttggcagcagtcacatcaccagtttaggaagcgactagtagaa
gagtatgccttgtatccagacactgtggccccattactggcgtccatcttgcagttgcag
catggcatgaggcttgtggcatctgaagtccatgcctccctccacagcggtgtgctctgt
gcagagaatctgggggccctggccatggctgtgctagctttcccatctgtgggccccagc
ttccctacctaccatgctcatgcagatgctttgtgctcagtgaacgctgcggaagctctt
cgaagtcttgggaaactgatggtcaagcgtgcagcaagaaaggaagaagccaagagccag
caagcttatcctacccgggagcagttgctgatgaatgctctcctttacctgcgctctcat
gtgctgtgcaaaggggagctagaccagagggcccttctgctcttcagacatctgtgtcaa
gagatcatcaacgaatgggatgagcaggagcggatagcccaagagaaggcagagcaagag
agtagcctgtatagataccggagcaggagcggcaggacagccctgagtgaggaggaggag
gaggaactggagctcaggaaactgttcccactgcatgaaaaggactttgcagatattttg
atggaaccaacactagaagagaaaaagaaagtttcagatggaagagaagaggaagcagcc
ccagacccaactttgctgtgccagagttcaatgcaggcggtgatgctgatccaccagcag
ttgtgcctcagctttgcacgctccctgtggtaccaacaggctgtgccaccacatgaagca
aagcactacctcagcctgttcctttcttgctatcagactggagcatctctggtgacacac
ttctaccctctgatgggagtcgagctgaatgaccagctcttgggaagtcagctgttggct
tgtacactctcctctaacacactctgtggggaagctacctcagacctgatgatgaggcct
gacgggccctatgatttctaccagcaccccaatgtggcagaggcacggcagtgccaacct
gtgcttcaaggcttctcagaagctgtcagtcagctgctccaggactggccagagcaccct
gtacttcaacagctactggttgtaatggacagaattcgtggtttcccgctttccagtccc
atctccaaattcctgaatggcttagagatccttctagcaaaggcacaggattgggaggag
aatgcaagtcgagtactgtctctccggaaacatcttgatctagtcagtcagatgatcatt
cggtggcgtaagctggagctgaactgctggtcaatgagtttggataataccatgatacgc
catactgagaaatctaccaaacactggttttccatctatcagatgttggagaagcacatg
caggaacgcacagaggagcaggaagatgacaagcagatgactctgatgttgctggttagc
acactacaagcatttattgaaggatcttcgctgggagaattccatgtgcgactccagatg
ttgctggttttccattgtcatgtcttactgatgccgcaagtagaaggaaaagattcactc
tgcagtgttctgtggaatttgtaccatttttacaagcaatttcttgacccggtcaaagct
aaaattatggaacttcgctcccccatagaaaaagagcttaaagaatttgtgaagatatca
aagtggaatgatgtcagcttctggtccattaaacaatctgtggaaaagacacataggacc
ctctttaaattcatgaagaaatttgaagctgtgctgagtgaaccctgtcagtcatgtctg
gtagagagcgacaaggaagagcagcctgactgtttgccaaagccgacagaggaagctaca
atggagacatcgcccattcagggtctcaacaatgcactgagggagaccctgttagcacaa
ccagtagaatggaagccttcaggtacagaacagtgccaggatgccagtcctttgtctgtg
gagggagagcttctgcgtcgtttgccacgactctcaaaacgaatgaggaaaatgtgcctg
gtatttatgaaggagagtcccttgcctcacctagtggaaagtcttgaccagttcactggt
ggcgtgatttcatctgtaagtgagctgcagagcttaaaggtggatccctctgctgagaaa
gagaagcagcactcagaagccaaacacatactcctgcagaaacaccgcgctttatcagac
ctctttaagcacctggccaacattggtctatcatatcgaaaaggtcttgcctgggcccgt
tcaaaaagtcctcaggagttactccaccttcacccgttagatctccggagcgcattgtcc
atagtcagcagcactcgggaggccgattctaggctcctcacagaaatttcatctttgtgg
gatgggtgccagaagtacttttatcgctctcttgcacggcacaccaggcttactgcagca
ctagcaactcctgtcaaggaagtcagcatgggtaccattgagagatgcaaagggttctca
gcccacttgatgaagctgctcatccgacagcgtcactctctgaccacactgactgagcag
tggatcatcctcaggaacctcctcagctgtgtacaagaaattcacagcaggctgactggg
ccccctgtctatcccgtggccttcccgcctcaggacagtgtgcagcagtggacagagcga
ctgcagcacctggccatgcagagccagatcctcctggagcagttctcctggctcttccag
tgctgtcccagtgcagagccaactgtaggccacagagatgcccaagttcaggaacaccct
tctgcctctcatctggaaaacattgattttaaagagacaatagctggagtaatgccagac
ttactttcctctgatctgagctacccatccccagtacctacaagtcagctgccttctgct
tgccggatgaggagacaggatcagctttggcaacaatcaactgcagggttgacagagatg
ctgaaaactattaaaactatgaaggctggtgttgacaaaattaggcagcagtcttgtgag
accctctttcatacatgggaagattttgaagtttgctcttctgggctgaattgcctgtcc
caagtgtcagctcatttgcaaggcctagcgtccttgttcattcttccagggatagaggtt
gaacaaacagattcacgaatggccttagttgaaagcctggactatctaagaggagaagtc
agcaaagccatcgatgacttcactgcctggaaagcacgtctgttcgttgcacacaagcaa
gagggaaaccagatggtggaagaaagctttgttgaagacttttcagagcaagtagaaact
gccatccgggccattctctgcaccatccagaacttggcagaaagaaacaataagaaagca
gaagacagtgctgttgacaagagactgcaagaagaggatgaggcaagttttaagagcctg
cagccaggacatctaacaaagctcttagaggacgacttctgggcgagtgtgagcacttta
cacgtccagaaaatcatttcttctgtctccgagctgttggagaggctcaagtcctgcagt
gaggatggcaacacaaccaagcacaaggtcttcagccagtcctgtggcttgctagtgcgc
ctgatacccatcctgtgtggcttctcagaccttgtcctcttcttcctgaccgtatcgctg
gccactcaccggagcacggcaaagctgctctctgtgcttgcccagacctttacagagctc
tcccagaaggggttttgtttacctaaagaattgatggaagattccgcaggagagggagca
acgcagttccatgactacgagggaggtgggatcggagatggcgagggcatgaaggatgtg
agtgaccggatagaaaatgaggaacaggtagaagatacatttcagaagggtcaagagaag
gacgaggaagaccttgactcaaaacctgatactaaaggcgaggataacgccattgagatg
tcagaagactttgatgggaaaatgcatgatggcgagcttgaacaagaagaggatgatgag
aagtctgacagtgaggatggagacctggataagcagatgggcaatctcaatggcgaggaa
gctgacaaactagatgagaggctttggggagatgatgaggaagaagatgaagacggtgac
ggtagagctgaagagacaggaccaggggtggatgaggaagattctgaacttgttgctaaa
gatgacagcttggatgctggaaatttgaacaaaaataaaaaacatcaagatgagaaggaa
gactcagaacctgaagatgttgaacagggccaagagaaaattaatgaacaaattgatgag
agggaatatgatgagaatgaggtagacccttatcatggcaatcaagaaaagcttccagaa
cctgaggccttggaccttccagatgacttgaaacttgacagtgaggacaaaagtggtggt
gaggacacagacaatgaggaagcagaagaagagaatcctttggagatcaaagaaaaaacg
gtagatatggaagaaacagaccatgaaattgaagagcccggagctggtcaggatgaaggt
gaaagtccacatgagcctgaggaaggccccagtgaagacaaggagaatatggatatggat
acaggagctgatgatcaagacagagatacatccagccatgcagaagagcattccctggag
gaggaggcggaggaggaggaggagaagggggagaaggaggaagacaaggccaccactgat
ggaggtggagaaagtggtgtcaaccctgttgaccaaggtcttcagccccaggaagaggag
gaaggggagcagtctgatgctgaagagcaagtgccagaggccacagagagaaaggagcat
gccacctgtgggcagactggagtggacaatgtgcagagtgcacaggctgtggaactagct
ggggctgcaccagagaaggagcaggggaaagaggaacatggcagtggagctgcggatgca
aaccaagcagaaggccatgaatccaacttgattgcacgtttgtcctcccagcaacacacc
aacaaaaatacacagagttttaagaggagacctgggcaggctgacaatgaacgttccgta
ggtgactacaatgagcgtgtgcgtaagagactgaggactgtgggcacagacagagagact
gaacaggagccaacccaggctcaggtggaagatgcagacgcgttcgaacatgttaaacaa
ggcagtgatgcatatgatgcacaaacttatgatgtagccagtagtgaacagcagcagact
gcaaaggcctccggacaggatcaggaggaggaagaaatagaagatatcctcatggataca
gaggaggagctcatgagagcagaggacacagagcagctgaagccagaggcagtccagtca
gagactgctgcaacctctggctctagtgagatggaggtggatatgcaaacacttaagaca
aaagaagaccaagacccaagaacaaccacacctcaccaggagacagagaatgagaggcca
gaaagaagcagagattcaactattcatacgcttcgtcaattccttgtggattcagttttc
caacccattttaaaagatatcagtgagctgagacaagagatggaaaggcagctggagaca
tggcaggcgcacgactatgggaatgcagaagaagagaaggctgcagctgagatgtggcag
aattacctagtcttaactgcatctctttcacaacagctgtgtgagcagcttcgtctccta
ctagaacctacacaggcagccaaactaagaggagactatcgaacagggaaacgactgaac
atgcggaagatcattccatacattgccagtcagtttcgaaaagacaggatttggcttcgt
aggaccaagcccagtaaacggcagtatcagatttgtctggctatcgatgactcctcaagc
atggtagacaaccacaccaagcagcttgcatttgagtctttggccgtgattggtaacgct
ctaaccctcctagaagtgggtcagattgcagtgtgcagctttggagagtcagtaaagctg
ttgcacccattccacgagcagtttaatgattcttcagggactcatattctgcggctctgc
acgttccagcaaaggaagactaagattgctcagtttctagaaactgtagccaaaatgttt
gcagctgcccagaagttatcccagaacgtcagtccagagactgcccagctgctcctcata
gtttctgatgggcgaggccttttcctcgaaggcaaagacagagtcctagcagcagtccag
gctgcccagaatgccaacatcttcgtcatttttgttgtgttggataatcccaattcacgg
gattctatcttggacattaaagtaccaatatttaaaggaccaggagagatgcctgaaatc
cgatcctacatggaagagtttccatttccattttacatcattcttcgggatgtgaacgcg
cttcctgagaccctcagtgatgcgctcaggcagtggtttgagctggtgactgcatctgac
cactcctag

DBGET integrated database retrieval system