KEGG   Mus musculus (mouse): 100502766
Entry
100502766         CDS       T01002                                 

Gene name
Kifc1, 100042970, Gm4137, HSE, HSET, KN, KNSL2, Kifc, Kifc5a, Knsl2a, Tctex-7, Tctex-7A, Tctex7, Tctex7a
Definition
(RefSeq) kinesin family member C1
  KO
K10405  kinesin family member C1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    100502766 (Kifc1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    100502766 (Kifc1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100502766 (Kifc1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100502766 (Kifc1)
SSDB
Motif
Pfam: Kinesin Microtub_bd CENP-F_leu_zip Crescentin ATG16 Filament C2-set HOOK Spc7 Myosin_tail_1 GAS SYCE1 YabA Macoilin
Other DBs
NCBI-GeneID: 100502766
NCBI-ProteinID: NP_001182227
MGI: 109596
Ensembl: ENSMUSG00000079553
Vega: OTTMUSG00000037214
UniProt: Q9QWT9
Position
17 B1; 17 17.98 cM
AA seq 674 aa
MDVQAQRPPLLEVKRNVELKAALVKSSSRVPLSASRLKRGPDQMEDALEPAKKRTRVMGA
VTKVDTSRPRGPLLSTVSQTQGHTAAQKGPKKTGPRGCSAIGTVLRSQKPVPAAPAQKPG
TSTAPVVVGKRAGKRPAWDLKGQLCDLNEELKRYREKTQTLELENRGLREQLREVQEQAT
TLGTERNTLEGELASVRSRAEQDQQRLETLSARVLELEECLGTRERLLQELQGERLQLQE
ERSTLSTQLEEQERRFQATEAALSSSQEEVVCLRQKTEAQVTLLAEQGDRLYGLEMERRR
LHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDPPTGLSLSRSDDRRST
LTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFT
MEGGPRGDPQLEGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRK
GQGGECEIRRASPGSEELTVTNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSH
SVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLHLGPGERDRLRETQAINSSLSTL
GLVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASK
VNQCVIGTAQANKK
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggacgtgcaggcgcagaggccacctttgttggaagtgaagaggaacgtagaactgaag
gcagccctggtgaagtcctcctcccgagtgcccctgtcagcaagcaggctcaagaggggt
cctgaccagatggaggatgccttggagcctgcaaagaaacggacacgagtcatgggtgca
gtgaccaaagttgacacatcccgtcccagaggaccactcctcagcacagtgtcacagacc
cagggccacactgcagctcagaaaggccctaagaagacaggacctcgtgggtgctctgct
attggtacagtgctgaggagccagaagccagttcccgctgctcctgcccagaagcctggc
acatccactgctcctgtggtggtagggaagagagctggcaaacgccctgcctgggacctg
aagggccagttgtgtgacctcaatgaagagttgaaacgctatcgggagaagactcaaacg
ctggaactggagaaccggggtcttcgggagcaactcagagaggtccaggagcaggccacg
accctggggacagagcggaacaccctggaaggggagctggccagtgtacgcagccgagct
gagcaggaccagcagaggctggagacgctgagtgcccgtgtcttggagctggaggaatgt
ctgggtaccagggaaaggctgcttcaggagcttcagggagagcggctgcaattgcaggag
gagcggagcacactgagcacccagctggaggagcaggagaggaggtttcaggccacagaa
gcagctctgtcaagcagccaagaagaggtggtgtgtcttcggcagaagactgaagcccag
gtgaccttactggctgagcaaggagaccggctctatgggttagagatggagcggcgacga
ctccacaaccagctgcaggaactgaagggcaatatccgggtgttctgccgcgtgcgccct
gtcctcgaaggggaatccactccatctcctggcttcctcgtgtttcctcctggccctgct
ggaccctctgatcccccgacgggccttagcctctcacgatctgatgatcggcgctccacc
ctgactggggccccggcccccactgtccgccatgatttctcctttgatcgggtgttcccg
ccgggaagcaagcaggaggaagtgtttgaggagatcgccatgcttgtccagtcagcactg
gatggctaccctgtgtgcatttttgcctatggacagacaggcagtggcaagaccttcact
atggaaggagggcctaggggagacccccaattggaagggctgatccctcgggccatgcgg
catctgttctctgtggcccaggagatgagcggccagggctggacatacagttttgtggcg
agttacgtagagatctacaatgagaccgttcgagacctgctagctactgggccccgcaag
ggacaagggggcgagtgtgagatccgtcgggcaagcccaggaagtgaggagcttactgtc
accaatgcccgctatgtccctgtttcctgtgagaaagaggtggaggccctgctccatttg
gctcatcagaaccgggctgtggcccacactgcccaaaataagagatcatcacgcagtcat
agtgtgttccagctgcagatttctggagagcatgcagctcggggcctgcagtgtggcgct
ccgctcaaccttgtggacctagctgggagtgagcggctagaccctggcttacacctaggc
cctggggagcgtgatcgtcttcgggagacacaggccattaacagcagtctgtctacactg
ggactggtcataatggccctgagcaataaggagtcccacgtgccttaccgaaacagcaag
ctcacctacttgctgcagaactctctgggtggcagtgccaagatgcttatgtttgtgaat
atttctcctctggaagagaatgtctccgagtctctgaattcactacgctttgcttccaag
gtgaaccagtgtgtcattggtactgctcaggctaataagaagtga

DBGET integrated database retrieval system