KEGG   Mus musculus (mouse): 100503041Help
Entry
100503041         CDS       T01002                                 

Gene name
Pdzd7, 9130207N01, EG435601, Pdzk7
Definition
(RefSeq) PDZ domain containing 7
  KO
K21882  PDZ domain-containing protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    100503041 (Pdzd7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    100503041 (Pdzd7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 100503041
NCBI-ProteinID: NP_001182194
MGI: 3608325
Ensembl: ENSMUSG00000074818
Vega: OTTMUSG00000033081
UniProt: E9Q9W7
Position
19; 19 C3
AA seq 1021 aa AA seqDB search
MARGFTVGFDPLGLGELSSGSLSSVSSRGHLGSDSGSTATRYLLRKQQRLLNGPSRGIRA
SSPMGRVILINSPIEANSDESDIIHAVRVEKSPSGRLGFSVRGGSEHGLGIFVSKVEEGS
SAERAGLCVGDKITEVNGLSLESTTMGSAVRLLTSSSCLHMMVRRMGRVPGIKFSKEKTT
WVDVVNRRLVVEKCSSTPSDRSSEDGVRRIVHLYTTSDDFCLGFNIRGGKEFGLGIYVSK
VDHGGLAEENGIKVGDQVLAANGVRFDDISHSQAVEVLKGQTHIMLTIKETGRYPAYKEM
VSEYCWLDRLSNGVLQQLSPASESSSSVSSYASSAPCSSGSLPSDRMDVCLGPEEPTSHG
PGWGRADTAMQTEPDLDSRVETWCSVRPTVILRDTAIRSDGPSSTRHLDSALSESPKTAL
LLALSRPRTPITRSQSHLTLWEEKKQRKKEKSGSSGEKGALQRSKTLMNLFFKGGRQGRP
AGDGHREAWTLDSRSPTKVRPRLDLEKAGSVGPVQKFVTWRLRRDRERGRALLSARSGSP
SGQAPTVNEQVQAWESRRPLIQDLARRLLTDDEVLAVTRHCSRYVHEGGVEDLVRPLLAI
LDRPTKLLLLRDIRSVVAPTDLGRFDSMVMPVELEAFEALKSRAVGPSALRPTRQDTPPK
RHLITPVPDSRGGFYLLPVNSSEDEDGEIREKLGVLKVSLGASAPHHKGIPPLQDVPVDA
FSLRRGACAPPPQPPPVAPRPPRPNWLLTEPLSREDTQQNQSQTPAQSCSRSRSRSRSRS
HSRGQGKSPGRRRSPSPAPIATAATANGRYHRPRKARPLLPRLLDGQVAKVGARQGPLEN
GRIAEEAVGNVSTGALRTITLSKMKQSLGISISGGIESKVQPMVKIEKIFPGGAAFLCGD
LQAGFELVAVDGESLEQVTHQRAVDTIRRAYRNKAREPMELVVRVPGPGLLPLASDLRVV
KDQSLAPDCPSALGPVDDARILTQLPPPEARQLQQSLSSALKVPQSIPKLSPILKDPHDP
S
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtggtttcacggtaggctttgacccactgggtctaggagaactcagctctggc
tccctgagctctgtctcctcccgaggccacctgggcagcgactcaggctccacagcaaca
cgatacctgctgaggaagcagcagcgcctgctgaatgggccctcccgaggaattcgagcc
tcctcgcccatgggccgggtcatcctcatcaactcccccatcgaagccaacagtgacgaa
agtgacatcatccacgccgttcgcgtggagaagagcccctcggggaggctgggtttcagc
gtgagaggcggctctgagcatggcttgggtatctttgtcagcaaggtggaggagggaagc
agcgcagagcgggctggcctgtgtgtgggagacaagatcacggaggtgaacgggctgagc
ctagagagcaccacaatggggagcgctgtgaggctgctgaccagtagcagctgcctacac
atgatggtccggcgcatgggccgagtgcccggcatcaagttctccaaggagaagaccaca
tgggtggatgtagtgaaccggaggctggtggtagagaagtgcagttcaacgccgtcggac
cgcagctcggaagacggtgtgcgccgcatcgtccatctctatacaacctcggatgacttc
tgcctaggcttcaacatcagagggggcaaagagtttggcctgggcatctacgtgtccaaa
gtggaccatggggggctggctgaagagaacggcatcaaagtgggggaccaggtcctggcg
gccaacggtgtcaggttcgatgacatcagccacagccaggccgtggaggtgctgaaggga
caaacgcacatcatgttgaccatcaaggagactggccgataccctgcctacaaagagatg
gtttcagagtactgctggctggatagattgagcaatggggtactgcagcagctgtcgcca
gcctccgagagcagctccagcgtctcctcctatgcctctagcgccccctgcagctcgggc
tcgctgccctctgaccgcatggatgtctgtctggggccagaggagcccactagccatggc
ccaggctgggggcgggcagacacggccatgcagactgagcctgacctggacagccgagtg
gaaacttggtgcagcgtaaggccgaccgtcatcctcagggacacggccatccgctcggat
ggtccctcttctacccgacaccttgattctgcactttcagagtcccccaagactgctctc
cttctggccctcagccgacccagaactcccatcactcgatcccagagccacctgacactg
tgggaggagaagaaacaacggaagaaggagaagtcgggatcttctggggagaagggggcc
ttgcagcgctccaagacgctgatgaacctcttcttcaagggagggcggcaggggcggcca
gcaggggacgggcacagagaggcctggacactggacagcagaagccccaccaaagtccgc
cctcgcctggacctagagaaagcggggagtgtggggcctgtgcagaagtttgtcacctgg
agactaagacgagaccgggagaggggccgggccctgctctccgccaggtctggaagcccc
tctggccaggcacccactgtgaatgagcaggtgcaggcctgggaaagtcgacggcccctc
attcaggacctggcccggaggctgctgacagacgatgaggtactagcagtcactcgccac
tgctcccggtatgtccatgagggtggtgtggaggatctggtgcgccccctgctggccatc
ctagacaggcccacgaagctgctgttgctgagggacatcaggagcgtggtggcccccaca
gaccttggccgcttcgatagcatggtgatgcctgtggagctggaggcttttgaggctctt
aagagcagggcagtggggccttctgctttgagacctaccaggcaagacacgccacccaaa
cgtcacctcatcacccctgtgcctgatagccgtgggggcttttacctgctaccagtgaac
agctcagaggatgaagacggagagataagggagaagcttggggtccttaaggtctccctc
ggtgcctctgctcctcaccacaagggaatcccccctctacaagacgtgccagttgatgcc
ttttcgctacgccgaggcgcatgcgcacctcctccccagccacctcctgtggctccccga
cctcccaggcctaactggctactgacagaacccctaagcagagaggacactcagcagaac
cagagccagaccccagcccaaagctgcagccgcagtcgcagccgcagccgcagtcgcagc
cacagccgaggtcaaggcaagtctcctgggcgcaggcgctccccttccccggcacccatc
gccactgctgccacagccaacgggcgttaccacaggcctcggaaagcaaggcccctgctt
ccacgacttctggatgggcaggtggccaaagtgggagccaggcaagggcccttggagaat
ggtcggatagctgaggaagcagtcgggaatgtctccactggagcgctgaggaccatcaca
ctatccaagatgaagcagtctttgggcattagcatctctgggggcatcgagtccaaggtg
cagcccatggtgaagatagagaagatctttcccggaggtgcagctttcctctgcggggat
ctacaggctggctttgagctggtggcagtggatggcgaaagcctggagcaggtaacccac
cagcgagcagtggacaccatccgcagggcttaccgaaacaaggctcgggaacctatggaa
cttgtggtcagggtccctgggcctggcctgctgcccctagcctctgacctacgagttgtt
aaggaccagagccttgctcctgactgtccctccgcccttggacctgttgatgatgctcgg
attctcacccagctacctccccctgaggctaggcaactccagcagtctctcagctcagct
ctaaaggtccctcaaagtatccctaaactctcccctatacttaaggatccccatgaccct
tcctag

DBGET integrated database retrieval system