KEGG   Mus musculus (mouse): 100515
Entry
100515            CDS       T01002                                 

Symbol
Zfp518b, 6820424L24Rik, AA410078, AI661722, Znf518b
Name
(RefSeq) zinc finger protein 518B
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_5 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-CSL
Other DBs
NCBI-GeneID: 100515
NCBI-ProteinID: NP_001074613
MGI: 2140750
Ensembl: ENSMUSG00000046572
Vega: OTTMUSG00000042276
UniProt: J3QPN0
Position
5; 5 B3
AA seq 1082 aa
MQIREMKDIGEQLYTTQVNGGPSSLTMSPKQPNRATRTERQEAQTLLYQGSEAEAATMTI
ATCVQCKSVHKIPTQDLRKGPGQSQDTYVCFKCSLRAVPTQLHFVNNNAGAAHVRNETET
ISSPVNKFKVRNFKPGKYYCDKCRFSTKDPLQYRKHTLQHEEIRFICSHCSYISYTKGEF
QRHLVKHTGIFPYRCEYCDYGAIRNDYIVKHRRRVHERAGAKRPFKTVAKLEPKRTSIPK
QSMELSKGPSPRAAFQNKLSDQLSRFSLHANKDKTHNLMLLPELKKYQKDVVCIPNKVTL
SEPREVSLLGNKNVEVEVLSPSKEPVHPGMPLTVMAPSELVVPTNCLAQLMDVKVVNGAQ
QLVLKLFPLEENARLETSRGDGGTSECLSTEKGSGGQKKMLSPEASRSLAVEGNAGDFVG
LDRLHSLVQKQLKNVKWVKSCNFFMPNSGVHSQQESFLGSDTIKELQKSHSLCPPRALPS
AAIKSHSPASVQNSVPYGPGATVSHFLSKAAVAFADDRRGARSNSQQLLPLASLPSKVPF
SGEKGLLPIGESDLEARNRISRPETLVSSDRKLEDKQMESKAVGNTGQVSSVQNKEYLHI
NITGEDKPRSQQPGDQPGQPKTSETAGATFEGPIISSVFSLSSGSENVPEAIKWNSSTTK
IKSIELLRRKIAQLIESCGKPSSLSANSAQRRSIGQAPKLTSKATPKAIQEMSVSLTGPG
PTPGPSVGPLQKPPNEDSITGSRQLVPQQVCPQFISANDGKMENRVTRKTPVATPVLIPK
GAVLRVLNSSEDAHIIEATCDTPVSIPCSEAQLAGTLPFCPMKQTGSGSQPLTCRSGPAD
MSPGLETSLRPKSRKEDTICSATAKKMVPVYSTAPGSSDSIRQGRPVSRNLTVSKNKTKQ
VNSTKKKNKMQANPGRYFKDPPSFFQVARQLRLIAAKPDQLIKCPRRNQPVIVLNHPDVD
SPEVTNVMKVINKYKGNVLKVVLSERTRCQLGVRRYHMRLTYQNVAETNHMKRQMMLKMK
LKKVHKNNYQVVGSMPDDPAQCVFKCWFCGRLYEDQEEWMSHGQRHLIEATRDWDVLSSK
GK
NT seq 3249 nt   +upstreamnt  +downstreamnt
atgcagataagggagatgaaggatattggagaacaactctataccacacaagtgaatggg
ggacccagttccttgaccatgtcccccaaacaacctaatagagcaactcggacggagaga
caggaagctcagaccctattgtaccaaggttcagaggcagaggctgccaccatgaccatt
gctacttgtgtacagtgcaaaagtgttcacaagatccccactcaagacttgaggaaaggc
cctgggcagagccaagacacttatgtctgctttaagtgcagccttcgagcagtgcctacc
cagctgcattttgtgaacaacaacgctggtgctgcgcatgtcagaaatgaaacggaaacc
atctcgagccctgtaaataaatttaaggttaggaacttcaagccaggcaaatactactgt
gataagtgtcgcttctctacaaaggacccactgcagtaccgaaagcacacgctgcagcac
gaggagatcaggttcatctgttcccactgcagctacatctcctacacgaaaggggagttc
cagagacatctggtgaagcacacgggcatcttcccttatcgctgtgagtactgcgactat
ggtgctattcgcaatgactacatcgtcaagcacaggaggagggtccacgagcgggctggg
gccaagcggccattcaaaactgtggccaagctggaacccaagagaaccagcatcccaaag
cagagcatggaactctcaaagggccccagtcccagggctgccttccaaaacaagttgtcg
gaccagctgtctcggttctctctccacgcgaacaaagacaagacacacaacctgatgtta
ttacccgagctaaagaagtaccaaaaagatgtagtgtgtattcccaacaaagtgaccctg
tccgagcccagggaggtgagcctgttggggaacaagaatgttgaggtggaagtgctgtcc
ccctcaaaggaacccgtgcatccagggatgccgctgaccgttatggcgccctcagagctg
gtggtccccaccaactgtctggcccagttgatggacgtgaaggttgtcaatggtgctcag
cagcttgtgcttaaactgtttccgttggaagaaaacgcccgcctggaaacgagccgagga
gatggaggcacttccgagtgtctgagtaccgagaagggctcagggggacagaaaaaaatg
ctttctccagaagcatcgaggtcactagccgtggaagggaatgccggagactttgtgggc
ctggatcgtctgcactctttggttcagaaacagcttaaaaatgtgaagtgggtgaagtct
tgcaattttttcatgccgaattctggtgtccacagtcaacaagaatctttcctcggttcc
gatacaatcaaggagttacagaaatctcacagtctgtgtccgcctcgagcccttccttct
gctgccataaaaagtcattctccagcctctgtacaaaatagtgttccctatggtcctggg
gccacagtgagccatttcttgagtaaagcagctgttgcttttgctgatgacagaagaggg
gcccgcagtaactcccagcagctcctgccgcttgcctctttgccttcaaaggttcccttc
tctggagagaagggcttattgcctataggtgaaagtgacttagaagcgaggaataggatt
agtcgtcctgaaaccttggtttcctctgataggaagctggaagacaagcagatggaaagc
aaggcagtgggaaatacgggccaggtttcctctgtgcagaataaagagtatttacacata
aacataactggagaagataaaccgaggtcccaacagcctggggatcagcctgggcagccc
aagacttctgaaacagcaggtgccacgtttgaaggcccaatcatctcatccgtgttttcg
ctgagctctggatctgaaaatgtaccggaggccattaaatggaatagctcaaccaccaaa
ataaagtccattgaactgctgcgcagaaagatagctcagttgattgaatcttgtggcaag
ccttcctctttgtctgccaatagtgctcagcgacgttccataggtcaggcaccaaagctg
acctcaaaagcaactcccaaggctattcaagaaatgagtgtgtcccttactggccctggc
cctacccctggcccttctgtgggtcctctccaaaaacctccaaacgaggacagtattact
ggcagcagacagcttgttccacagcaggtctgtccccagtttatcagtgctaatgatggg
aaaatggaaaacagagtgaccagaaagactcctgttgctactccagtgctgatccccaaa
ggggccgtgttgagggtccttaactcttctgaagatgctcacatcatagaggctacctgt
gacacacctgttagcataccttgcagcgaagcccagttagcaggaacacttccattctgc
cctatgaaacagacaggctcgggctcccagcccttgacatgcagaagtggaccggcagac
atgtctcccggtctggagacatctcttcggcccaaatctagaaaagaggacacaatctgc
agtgccactgctaagaaaatggtccctgtgtacagcacggcaccaggaagcagtgactcc
atcaggcaaggaaggccagtttctagaaacctaactgtaagcaagaataaaaccaagcaa
gtgaactcaaccaagaagaagaacaagatgcaggccaatcccggccgttatttcaaagac
cccccctccttttttcaggtggcaaggcagctgcgcctcatagctgccaaaccagatcag
ttgattaaatgtccccgtcggaaccagcctgtcattgtgctaaatcatcctgacgttgac
tcccccgaagtgaccaatgtgatgaaggtaatcaacaagtacaaaggcaatgtcctcaag
gttgtcctgtctgagaggactaggtgtcagctgggtgtccggcggtaccatatgcggctg
acctaccagaatgtggcagaaactaaccacatgaagaggcagatgatgttgaaaatgaaa
ctgaagaaggttcataaaaacaactatcaggtggtgggctcgatgccggacgaccccgcc
cagtgtgtctttaagtgctggttctgtgggaggctctacgaagaccaggaagagtggatg
agtcacggccagaggcatttgatagaggccaccagagactgggatgtcctctcttcaaag
ggcaaatga

DBGET integrated database retrieval system