KEGG   Mus musculus (house mouse): 103573
Entry
103573            CDS       T01002                                 
Symbol
Xpo1, AA420417, Crm1, Exp1
Name
(RefSeq) exportin 1
  KO
K14290  exportin-1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu03013  Nucleocytoplasmic transport
mmu03250  Viral life cycle - HIV-1
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    103573 (Xpo1)
   03008 Ribosome biogenesis in eukaryotes
    103573 (Xpo1)
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    103573 (Xpo1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103573 (Xpo1)
   05164 Influenza A
    103573 (Xpo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    103573 (Xpo1)
   03009 Ribosome biogenesis [BR:mmu03009]
    103573 (Xpo1)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    103573 (Xpo1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    103573 (Xpo1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     103573 (Xpo1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    103573 (Xpo1)
  Pre-60S particles
    103573 (Xpo1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    103573 (Xpo1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     103573 (Xpo1)
SSDB
Motif
Pfam: CRM1_C Xpo1 CRM1_repeat_2 CRM1_repeat_3 CRM1_repeat IBN_N Hydrolase_3 BspA_v
Other DBs
NCBI-GeneID: 103573
NCBI-ProteinID: NP_001030303
MGI: 2144013
Ensembl: ENSMUSG00000020290
UniProt: Q6P5F9 Q8BYY5
Structure
Position
11:23205909..23247597
AA seq 1071 aa
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKL
QNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
PLNPGNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD
NT seq 3216 nt   +upstreamnt  +downstreamnt
atgccagcaattatgacaatgttagcagaccatgcagctcgtcagctgcttgatttcagc
caaaaactggatatcaaccttttagacaacgtggtgaattgcttataccatggagaagga
gcccagcaaagaatggctcaagaagtactgacacatttaaaggagcatcctgatgcttgg
acacgggtcgacacaatattggagttttcgcagaacatgaacacgaaatactatggacta
cagattttggaaaatgtgatcaaaacaaggtggaagatccttccaaggaaccagtgtgaa
ggaataaaaaaatatgttgttggtctcattatcaagacatcctctgacccaacttgtgta
gagaaagaaaaggtgtatattgggaaattgaatatgattcttgttcagatacttaagcaa
gagtggcctaagcattggccaacttttatcagtgacattgttggagcgagtaggaccagt
gaaagtctatgtcaaaataatatggtgattcttaaactcttgagtgaagaagtgtttgat
ttctctagtggacagataacccaagttaaagcaaagcatttaaaagacagcatgtgcaat
gagttttcacaaatatttcagctttgtcagtttgtgatggaaaattcccaaaatgctccc
cttgttcatgctacattagaaacactgctgagatttctgaactggattccactgggatac
atctttgagaccaagttaatcagcacattaatttacaagttcctgaatgttccaatgttc
cgaaatgtgtctctaaagtgcctcactgagattgctggtgtgagtgtaagccaatatgag
gaacaatttgaaactctgtttacacttacaatgatgcagctaaaacagatgcttccttta
aacactaatatccgacttgcatactcgaatgggaaagatgatgaacagaactttattcaa
aatctcagcctgtttctctgtacctttctaaaagagcacggtcaacttctagaaaaacga
ctgaatctcagggaagcactcatggaggctcttcattatatgttgttggtgtctgaagtg
gaagaaactgaaatttttaaaatctgccttgagtactggaatcatttggcagctgagctc
tacagagagagtccattttctacatctgcttctcccttgttatctggaagtcaacacttt
gatattcctcctaggagacagctgtacttgaccgtgttatcaaaggtccgtttattgatg
gttagtcgcatggctaaaccagaggaggtactggttgtagaaaatgatcagggagaagtt
gtaagagagttcatgaaggatactgattccataaatttatataagaatatgagagaaaca
ttagtttatcttactcatctggattatgtagatacggaaataataatgactaagaaactt
caaaatcaagtgaatggtacagaatggtcatggaagaatttgaatacgttgtgttgggca
ataggctccatcagtggcgcaatgcatgaagaggatgagaagcggtttcttgttactgtt
ataaaggatcttttaggattatgtgagcagaaaagaggcaaagataataaagctattatt
gcatcgaatatcatgtacatagtaggtcaatacccaagatttttgagagcacactggaaa
tttttgaagacagtagtaaacaagctattcgaattcatgcatgagacccatgatggagtc
caggatatggcttgtgacacatttattaaaatagctcaaaaatgccgtaggcattttgtt
caggttcaagttggagaagtaatgccgttcattgatgagattttaaacaacataaatact
ataatttgtgatcttcagcctcagcaggttcatacattttatgaagctgtggggtacatg
attggtgcacagacagaccagacagttcaagagcatttgatagaaaaatacatgctactc
cctaatcaagtgtgggacagtataattcagcaggctaccaaaaatgtggatatcctgaaa
gatcctgaaacagtcaagcagctgggtagcatattaaaaacaaatgtgagagcctgcaaa
gctgttggtcatccctttgtaattcagcttggcagaatttatttagacatgcttaatgta
tataagtgcctcagtgaaaatatttctgcagctattcaagctaatggtgagatggttaca
aagcaaccattgattagaagtatgcggacagtaaaaagggaaactttaaagttaatatct
ggttgggtgagccgttccaatgatcctcagatggtagctgaaaactttgttcctcctttg
ttggatgcagttcttattgattaccagagaaatgtaccagctgctagagaaccagaagtg
cttagtactatggccattattgtcaacaaattaggtggacatataacagctgaaatacct
caaatattcgatgcagtttttgagtgcacattgaatatgataaataaggattttgaagag
tatccagaacacagaacaaactttttcttattacttcaagctgtcaattctcactgtttc
ccagcattcctagctattccacctgcacagttcaagctggttttggattctattatttgg
gcttttaaacatactatgaggaatgttgcagatacaggcttacagatactttttacactt
ttacaaaatgttgcacaagaggaagctgccgcacagagtttttatcaaacttatttttgt
gatattcttcagcatattttctctgttgtaacagacacttcacatactgcaggtctaaca
atgcatgcatcaattcttgcatatatgtttaatttggttgaagaaggaaaaataagtaca
ccactaaatcctggaaatccagttaacaaccaaatgtttattcaagactatgtggctaat
ctccttaaatctgcattccctcatctacaagatgctcaagtaaagctctttgtaacagga
cttttcagcttaaatcaggatattcctgctttcaaagaacacctaagggatttcttagtt
caaataaaggagtttgcaggtgaagatacatcggatctatttttggaagaaagagaaaca
gcccttcgacaggctcaggaggagaaacataaacttcaaatgtctgtacctgggattctt
aatccacacgaaattccagaagaaatgtgtgattaa

DBGET integrated database retrieval system