KEGG   Mus musculus (house mouse): 105377
Entry
105377            CDS       T01002                                 
Symbol
Slf1, 2700017A04Rik, Ankrd32, Brctd1, Brctx, C730024G01Rik
Name
(RefSeq) SMC5-SMC6 complex localization factor 1
  KO
K26126  SMC5-SMC6 complex localization factor protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    105377 (Slf1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     105377 (Slf1)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4 RTT107_BRCT_5 DUF5550 HopW1-1
Other DBs
NCBI-GeneID: 105377
NCBI-ProteinID: NP_598832
MGI: 2145448
Ensembl: ENSMUSG00000021597
UniProt: Q8R3P9
Position
13:complement(77191207..77283632)
AA seq 1054 aa
MEDSATKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWVLTKDYIIHSAKSGRWLDETTYEWGYKIEKDSHYSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRADKRSDSLVRVLEAGKANVILPKNSPSGITHVIASNARISAEREQE
NFKAPFYPIQYLGDFLLEKEIQNDEHSQISPAWTKYNNQEKGNDVGFPEMKGAGENMYRT
QNKMENHNKNVSDRFVLSEHHKKKFKDFRKDIRSVKKRNTLRRHGLENQKETKKKDKNIQ
RSYILRKKNKKEGYCKTDDAHDTIRSMLKKRGHYREQKEMKNPLLTDGTKESKTKDVKTN
MNLIEIKNALKKQIYKDIYRAQAVRYNCIRVDKQPVYNVEVKNSEFPRGILNLIENLIEG
QFFKEAIEELSSLQAHYIPPVCLLHAILENVLQDKIDTFSGRYFHILSALLHLHPPWKSP
AMLKYYLELFQCPTCMKGAWDFTEVLIRSCLFNEDFCHQISENISTKVVNLTLLKFFFNL
LEGEVRHLSQKLCDWSDSQSLKVTEKAILHEIFWSGSETSGLLTKPVNMLLEWTIYSHKE
KCKSNDVFKHELSYLLTGILGAAVDYWIFLGIQMGRNVIRHMSDDLGSYISLSCDDFSSK
ELEIFICSFSSSWLQMFVAEAIFKKLCLQGPTSTCTEPLSLQKIIDSYLPILGKMDIHGA
GKMQSPKKLCQRPCLESQRALLMLNGAKRKQAEGRPELLELNRAKCSSSLKKLKKKSEEL
SCSKENCPSLVTKMNFHKTNLKGETALHRVCIKNQVEKLIILLSLPGIDINVKDNAGWTP
LHEACNYGNTECVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQRGGPELLQ
QRNSKGELPLDYVLSPKDKEELFAITNIDDTVDNFHAKTQKHFYHQQLEFGSFLLSRMLI
NFCSIFDLSSEFILAFKGLGHLNELLMACNSDTEASNAHTDWLLDVYARNIKTLKKLPSV
LKELPENLNVCPGVHTEALLVTLKMMCQSITELS
NT seq 3165 nt   +upstreamnt  +downstreamnt
atggaagatagtgccacaaaacatatcatccaaatgacaggatttaagatggaagaaaag
gaagctctagtcaaattgcttttaaaactagattgcacttttattaagagtgagaaatat
aaaaactgtacacatcttatagctgaacgactgtgcaagagtgagaagtttttagcagct
tgtgcagcaggaaaatgggtattaacaaaggattacataattcacagtgccaaaagtggc
agatggcttgatgaaacaacttatgaatggggatataaaattgaaaaagactcccattat
tcacctcaaatgcaatctgcacctaaaagatggcgtgaagagctgaaacggactggtgct
cctggggccttccacagatggaaagttgttctccttgttagggcagataagcggagtgac
tctcttgtaagagttttggaggctggaaaagcaaatgtcattttaccaaaaaattctcca
agtgggataacacatgtgattgccagtaatgcaagaatcagtgctgaaagagagcaagaa
aactttaaggctccattttatccaattcagtatttaggagattttctattagagaaagaa
attcagaatgatgaacattcccaaatcagtcctgcttggaccaaatacaacaatcaagaa
aaaggaaatgatgtgggatttcctgaaatgaaaggtgctggagaaaacatgtatagaact
cagaataaaatggaaaatcataataaaaatgttagtgatagatttgttctgagtgaacat
cacaaaaaaaaattcaaagacttcagaaaagatataagatctgttaaaaagagaaataca
ctcagaagacatggacttgagaatcagaaagaaactaagaaaaaggataaaaatatccaa
aggagttacattttgaggaaaaagaacaaaaaagaaggttattgcaaaactgatgatgcc
catgatacaattagaagtatgttaaagaagcgtgggcattacagagagcagaaagaaatg
aagaatcctcttcttactgatggtaccaaagaatcaaagaccaaggatgtcaagacaaat
atgaatctcattgaaataaaaaatgccttaaagaagcagatatacaaggacatatataga
gctcaggctgtccgatacaactgcattagagtagataaacagcctgtatacaatgtagag
gttaaaaattctgagttccctagaggaatattaaacttaatcgaaaacctcatagaggga
cagttctttaaagaagccattgaggagctttcctctttgcaagctcattatatccctcct
gtgtgccttctccatgccattctagagaatgttctgcaggataaaatagacacattttct
ggtcgatactttcatatattatcagctcttcttcatctgcatcctccttggaagtcacca
gccatgttaaaatactacttagagctatttcagtgtccaacttgtatgaaaggagcctgg
gatttcacggaggtgctcatcaggtcatgtcttttcaatgaagatttttgccatcaaata
tcagaaaatattagtactaaggtggtcaatctcacattgctcaagtttttctttaattta
cttgaaggtgaagttcggcatttgagtcaaaagttatgtgactggtcagattctcagagt
ctaaaagtaacagaaaaggcaattcttcatgaaattttttggtcaggaagtgaaacttca
ggacttttgacaaaaccagtaaatatgcttttggaatggactatatattctcacaaggaa
aaatgcaagtctaatgatgtcttcaaacatgaactatcttacttactgactggaattctt
ggtgcagcagtagattactggatcttccttggtattcagatgggtagaaatgtgatccga
catatgtctgatgacttaggaagttatatttccctttcctgtgatgacttttcttcaaaa
gaactagagatcttcatttgttccttttcatcttcctggcttcaaatgtttgttgcagaa
gcaatttttaaaaagctgtgcttacagggccccactagtacgtgcactgagccactctct
cttcagaaaataatagattcctatttgccaattttgggaaaaatggacatacatggggct
ggaaagatgcagagtccaaaaaaactctgccagcggccttgcctagagtctcaaagagca
ttactaatgctgaatggtgcaaaacggaaacaagcagaaggtcggccagagctcctagag
ttaaaccgtgctaaatgttcctcatcattgaaaaaattgaaaaagaagtcagaggaattg
tcatgttccaaggagaattgcccatctttggttacaaagatgaattttcataaaactaat
ctgaaaggggaaacagctctgcatagagtttgcataaaaaaccaagtggagaaattgatt
atccttctgtctttgccaggaatagacatcaatgttaaagacaatgctggctggacgcct
ttgcatgaagcctgcaactatggcaacacggagtgtgtccaggaaattctgcagcgttgt
ccagaggtggatctgctcactcaagtggacggggtgacgcctttgcatgatgcgctgtca
aacggacatgtggagattggcaagctgcttctacagcgtgggggcccagaacttttacag
cagaggaactctaagggggagttgcccttggattatgtgctgtcccctaaggacaaggaa
gaactatttgccattacaaatatagacgatacagtggacaactttcatgctaagacacag
aaacatttttaccaccaacagcttgaatttggttcgtttttacttagtaggatgttgatt
aatttttgttcaatatttgatttgtcctcagaatttattctagctttcaaagggttaggt
catctaaatgagttgcttatggcatgcaatagtgatacagaagccagcaatgcacatact
gactggttattggatgtttatgctaggaatataaagacattaaagaagctcccaagtgtt
cttaaagagctgcctgagaatctaaatgtatgtcctggagtgcatactgaggccttactg
gtgacactgaaaatgatgtgtcagtcaatcacagagctgtcatga

DBGET integrated database retrieval system